Пкв прививка: Вакцинация против бактерий, известных как пневмококки, для профилактики инфекции среднего уха

Содержание

Вакцинация против пневмококковой инфекции

Восемь из десяти заболевших пневмонией и каждый третий, перенесший менингит, — жертвы этой инфекции. Streptococcus pneumonia – так на латыни звучит название виновника тяжелейших болезней, уже закончившихся трагически для полутора миллионов жителей Земли.

Быстро распространяясь с кровотоком по организму, пневмококковая инфекция поражает не только легочную ткань, но и другие жизненно важные органы:

  • Мозг – с дальнейшим развитием гнойного менингита.
  • ЛОР-органы – с развитием отитов, синуситов, фарингитов, ангин.
  • Кишечник, где под ее влиянием возникает перитонит.
  • Сердце – с поражением эндокарда.
  • Кроветворную систему – с возникновением сепсиса

Как происходит заражение

Пневмококком можно заразиться от уже болеющих людей и от бактерионосителей, которые сами здоровы, но выделяют инфекцию с дыханием или при чихании. У них инфекция гнездится в носоглотке, однако барьерные органы не дают ей опуститься вниз, к легким. Препятствуют ее размножению и распространению также носовая слизь, слюна, реснитчатые клетки органов дыхания и вырабатываемый ими секрет, который способствует очищению слизистых от патогенных организмов.

Эту систему иногда нарушает влияние внешних и внутренних факторов:

  • Переохлаждение
  • Переутомление
  • Психические стрессы
  • Недостаток витаминов

Все вместе или по отдельности они ослабляют иммунитет и очередная атака пневмококковой инфекции заканчивается болезнью.

Кому особенно необходима прививка

Воспаление легких, вызванное Streptococcus pneumonia, знает, куда нужно целиться наверняка: его добычей чаще всего становятся дети-дошкольники и пожилые люди, перешагнувшие шестидесятилетний рубеж.

Обязательно прививают детей с такими заболеваниями:

  • Хроническими патологиями сердца и почек
  • Серповидно-клеточной анемией
  • Иммунодефицитными состояниями

Взрослым (пожилым) людям очень рекомендуется пройти вакцинацию при любых хронических заболеваниях, способных угнетать иммунитет:

  • Сахарном диабете
  • Заболеваниях крови
  • Болезнях печени
  • ВИЧ-инфицированным

В России каждый год до 70 тысяч детей заболевают пневмококковой пневмонией.

Еще примерно 2,5 миллиона попадают к врачу с симптомами отита – крайне неприятного инфекционного заболевания, которое чревато опасными осложнениями вплоть до развития полной глухоты. Даже для такой большой страны, как Россия, это очень серьезные цифры.

Самый лучший и простой способ уберечь ребенка или пожилого члена семьи – сделать прививку от пневмококковой инфекции, которая доступна в любой поликлинике.

А также она необходима тем, кто перенес операцию по удалению селезенки – важного кроветворного органа, который выполняет и защитную функцию в организме.

Прививку от пневмококковой инфекции обязательно делают детям, воспитывающимся в детский домах, и старикам, которые живут в домах престарелых. Это связано с кучностью проживания и высокой вероятностью возникновения вспышек крупозной пневмонии, если вдруг заболевает кто-то один.

Преимущества вакцинации

  • Исследования показывают, что при условии проведения массовых прививочных кампаний частота заболевания крупозной пневмонией, гнойным менингитом и другими вариантами течения пневмококковой инфекции уменьшается в шесть раз.
  • Реже болеют привитые дети и взрослые и другими формами респираторных заболеваний – гриппом, ОРВИ, бронхитами. Значительно снижается число отитов, синуситов и ангин.
  • Даже если пневмококковое заражение все-таки наступает, болезнь протекает куда легче и никогда не заканчивается летально, а время лечения существенно укорачивается. Кроме того, в терапевтических схемах не приходится использовать сильные и дорогие препараты.
  • Доза вакцины стоит очень дорого и покупать ее самим разорительно для семейного бюджета. Государство берет на себя все затраты и дает возможность привиться бесплатно – так зачем ее упускать и подвергать себя риску тяжело заболеть?

Когда делать прививку

Первая пневмококковая прививка рекомендуется еще в грудном возрасте – ее назначают, когда малышу исполняется два — три месяца, после чего он с интервалом в 1,5 месяца получает еще два укола. Затем очень желательна ревакцинация в полуторагодовалом возрасте.

Так же рекомендуется прививание пожилых людей по достижении ими 60-летнего возраста. Вакцинация взрослым проводится однократно.

А как же люди более молодого возраста? У них тоже есть риск заболеть пневмонией – особенно если они работают в больницах, учебных заведениях, на торговых предприятиях и на транспорте. Прививка от пневмококковой инфекции станет надежной защитой от тяжелой и опасной болезни, поэтому если ваша профессия связана с людьми, лучше найти время для вакцинации.

Как подготовиться к вакцинации

Если взрослому или ребенку предстоит вакцинация от пневмококка , то нужно выполнить ряд важных условий, которые помогут избежать осложнений в будущем.

  1. На момент прививки здоровый ребенок или взрослый не должен иметь никаких признаков простуды – кашля, насморка или температуры. Чтобы знать это наверняка, лучше сдать основные клинические анализы крови и мочи.
  2. Хронические заболевания нужно перед вакцинацией пролечить, чтобы добиться стойкой ремиссии.

Прививка от пневмококковой инфекции детям должна проводиться только в день здорового ребенка – контакты с заболевшими детьми, ожидающими своей очереди в поликлиничных коридорах, могут привести к заражению другими инфекциями, которые через несколько дней обязательно дадут о себе знать и будут выглядеть как осложнения после полученной прививки.

Противопоказания

Пневмококковую прививку можно делать без опасений за собственное здоровье. Применяемые для этого вакцины высококачественны и имеют только стандартные противопоказания:

  • Непереносимость компонентов прививочного материала.
  • Ранее отмечавшаяся аллергия на такую же прививку, если по времени уже пора делать ревакцинацию.
  • Первые два триместра беременности, если нет отдельных рекомендаций врача.
  • Респираторные заболевания на момент вакцинации.
  • Обострение хронических патологий.
  • Лихорадочные состояния любого происхождения.

Возможные побочные эффекты

После прививки от пневмококковой инфекции у большинства детей и взрослых каких-либо выраженных побочных явлений обычно не бывает, однако врачи предупреждают о возможных недомоганиях, которые могут проявиться в первые 12-24 часа после вакцинации:

  • Кратковременный подъем температуры.
  • Реакции в месте инъекции – покраснение, болезненность, слабый зуд.
  • Общая картина недомогания – слабость, сонливость или, наоборот, бессонница

Все эти симптомы проходят максимум за сутки. Если они появляются спустя два-три дня после выполнения прививки от пневмококка , то можно сказать с уверенностью: вакцина тут точно не виновата. Очевидно, в день прививки ребенок или взрослый уже был слегка простужен, а небольшая доза препарата лишь ускорила болезнь – ту же ОРВИ или грипп.

Вот почему медики особенно настаивают на обследовании перед любыми прививками: во-первых, чтобы не спровоцировать начало другого инфекционного заболевания, а во-вторых – чтобы не дискредитировать саму идею вакцинации.

После прививки

Как вести себя после прививки? Вот несколько рекомендаций:

  • В первые сутки больше отдыхать.
  • Если температура поднялась выше 38, принять жаропонижающее.
  • Место укола ничем не обрабатывать.
  • Мыть малыша или мыться взрослому вполне можно: вода никак не влияет на кожу вокруг прививки

Обязательно обратиться к врачу придется, если температура держится или тем более нарастает дольше суток, а на месте инъекции появился отёк больше пяти сантиметров, уплотнение и выделения.

По материалам сайта pro-privivku.ru

Прививку можно сделать во всех подразделениях Токсовской МБ.

Вакцинацию против пневмококковой инфекции в 2018 году

Прививка от пневмококковой инфекции в Днепре


Пневмококковая инфекция – вызывается бактерией Streptococcus pneumonia, передается эта инфекция воздушно-капельным способом. Она признана одной из самых распространенных и опасных.
Как проявляется пневмококковая инфекция:

  • бронхит;
  • отит, синусит, фарингит;
  • сложное заболевание — пневмония;
  • гнойный менингит;
  • артроз.

Крайне опасной пневмококковая инфекция может быть для ребенка, поскольку вызывает осложнения и необратимые последствия. Для предотвращения развития заболеваний этой группы были разработаны специальные вакцины против инфекции пневмококк, позволяющие предотвратить заражение.

Что такое прививка от пневмококка?

Прививка против пневмококка начала разрабатываться только в прошлом столетии. Основная их сложность заключается в объемности группы бактерий возбудителей (они насчитывают более 90 типов). В конце 70-х начала использоваться 14-ти валентная вакцина, которая в дальнейшем улучшалась и совершенствовалась. Фармацевтические компании разработали в лабораториях конъюгированную вакцину, используемую и сегодня. Она является самым эффективным и действенным инструментом предотвращения заболеваний этой группы.
Вакцинация от пневмококка стимулирует организм сформировать свой устойчивый иммунитет к пневмококку, а в случае заболевания после полученной прививки, симптомы не так болезненны, не возникают осложнения.

Особенность бактерии пневмококка заключается в том, что она может не проявлять себя, при этом находясь в верхних дыхательных путях длительный период. Однако при возникновении «благоприятных» условий, она быстро активизируется и вызывает заболевание. К таким благоприятным условиям можно отнести:

  • переутомление;
  • переохлаждение;
  • стресс;
  • по какой-либо причине сниженный иммунитет;
  • регулярное курение.

Таким образом, достаточно привычные, для современного мира, процессы могут спровоцировать жизнедеятельность бактерии, которые в свою очередь вызывают сложные заболевания.

Схема вакцинации, которая запланирована от пневмококковой инфекции

6 недель — 6 месяцев 7-11 месяцев 1 — 5 лет
3 дозы + ревакцинация 2 дозы + ревакцинация 2 дозы, ревакцинация по показанию врача
3 дозы, интервал между ними будет не менее 30 дней, далее ревакцинация через 1-1,5 года 2 дозы, с интервалом не менее 30 дней, после чего будет проводиться ревакцинация в 2 года Вводится 2 дозы вакцины с небольшим интервалом не менее 2 месяцев

Врач, в зависимости от индивидуальных особенностей и состояния здоровья ребенка, может вносить коррективы в схему вакцинации, но при этом не стоит увеличивать интервалы между каждой последующей прививкой, поскольку это снижает эффективность действия курса.

Вакцинация от пневмококковой инфекции позволяет снизить детскую смертность от пневмонии на 70% | Курсив

Директор по научной деятельности и здравоохранению в компании GlaxoSmithKline Vaccines Отавио Синтра в интервью «Къ» рассказал о том, как влияет вакцинация против пневмококковой инфекции на показатели младенческой смертности, разнице между пневмококковыми вакцинами ПКВ-10 и ПКВ-13, а также о том как внедряются эти вакцины в мире.

В сентябре между компаниями GlaxoSmithKline (GSK) и Pfizer прошли дебаты «Рациональный выбор пневмококковых вакцин для программ вакцинопрофилактики в Казахстане». В рамках дебатов компании представили аргументы об эффективности вакцин ПКВ-10 компании GSK и ПКВ-13 от Pfizer. C 2010 года в Казахстане поэтапно внедрена вакцина ПКВ-13. Главная цель дебатов, по мнению г-на Синтра, состояла в том, чтобы добиться открытого тендера для выбора вакцины от пневмококковой инфекции.

- В рамках дебатов обсуждались вопросы о рисках при закупе вакцин только от одного производителя. Справедливы ли эти мнения и какой производственный цикл имеет вакцина?

- Риски зависимости от одного поставщика вполне очевидны. Всего лишь несколько компаний в мире способны наладить производство современных вакцин в глобальном масштабе. Производство вакцин – в отличие от производства химических препаратов – чрезвычайно сложный процесс. На всех этапах производства выполняются сотни тестов, гарантирующие качество вакцины. К примеру, процесс производства 10-валентной конъюгированной вакцины против пневмококковой инфекции от момента размещения заявки до выхода препарата с предприятия занимает 24 месяца.

- Поскольку мы говорим о детской вакцинации, на какой период действует вакцина, то есть до какого возраста защищен привитый ребенок?

- В настоящее время мы располагаем данными клинических исследований, что иммунитет против возбудителя продолжается в течение пяти лет. Возможно, что защита и более продолжительна. Чрезвычайно важно защитить ребенка в первые пять лет жизни, когда пневмококковая инфекция смертельно опасна для малыша. В старших возрастных группах пневмококковая инфекция также представляет угрозу, но эти риски ниже. О том, что защита продлится до старости после прививок, полученных на первом году жизни, говорить не приходится. По этой причине наши уважаемые оппоненты рекомендуют вакцинацию лиц старшего возраста. Однако при ограниченных ресурсах, об этом говорит и ВОЗ, нужно сосредоточиться на маленьких детях. И обе вакцины от пневмококковой инфекции - и 10- и 13-валентная - работают в этих возрастных группах.

- В этой связи я хотела бы уточнить, имеются ли данные по уровню смертности в мире от пневмококковой инфекции? И как они менялись под влиянием вакцинации?

- Нужно понимать, что детская и младенческая смертность - это интегральные показатели, которые отражают эффективность социальной политики государства и системы здравоохранения в целом. Что мы знаем наверняка, так это то, что внедрение пневмококковой вакцинации, универсальной вакцинации детей до двух лет при условии высокого охвата и продолжительности программы не менее трех лет, позволяет снизить смертность от пневмонии среди привитых на 15 -70%, а смертность от менингитов на 50 -70% (по данным систематического обзора эффективности 10- и 13- валентной вакцин против пневмококковой инфекции, проведенной Панамериканской организацией здравоохранения, PAHO, опубликованного в конце 2016 года). При оценке пневмококковых конъюгированных вакцин, проведенных центром IVAC (Международного центра по доступности вакцин), снижение смертности от всех причин, смертности от пневмоний, смертности от инвазивной пневмококковой инфекции варьирует в диапазоне 6-56% (апрель 2017 г.).

Важно, что влияние 13- и 10-валентной вакцин на общую детскую смертность после внедрения этих прививок, вполне сравнимо. Позвольте обратиться к опыту международных организаций (ВОЗ, ЮНЕСКО, GAVI и т.д. ) Если бы была принципиальная разница в эффективности этих препаратов, эти организации не стали бы работать с двумя вакцинами лишь из стратегического интереса. На уровне страны мы видим примеры, когда в системах здравоохранения присутствуют два препарата. К примеру, в Германии, где родитель выбирает вакцину по рекомендации врача, после чего родителю возвращаются средства, затраченные на вакцинацию. В Швеции различные вакцины применяются в зависимости от округа/ региона. В республике Казахстан министерство здравоохранения покупает за государственные деньги вакцину, а затем бесплатно предоставляет ее населению.

В Российской Федерации выбрана 13-валетная вакцина. Но я хочу подчеркнуть, что наши уважаемые оппоненты объявили о локализации производства на территории Российской Федерации. Узбекистан - это страна, которая получает помощь глобального альянса по вакцинам и иммунизации (GAVI), выбрал 13-валентную вакцину. Но мы не исключаем, что ситуация изменится – например, когда срок предоставления помощи от GAVI истечет и страна будет вкладывать в закупку вакцины уже свои деньги.

- Если говорить о количестве серотипов, то будет ли происходить их дальнейшее наращивание и повлияет ли это на эффективность действия вакцин против пневмококковой инфекции?

- В целом, производители вакцин, а именно GSK и Pfizer, идут не по пути наращивания серотипов, которых насчитывается порядка 92. Совершенно очевидно, что мы не сможем закрыть все, кроме того, появляются и новые серотипы. Мы ищем альтернативные пути профилактики пневмококковой инфекции. Очень важно понимать, что 92 серотипа пневмококков различаются по своей клинической значимости, способности персистировать, вызывать различные формы инфекции и т.д. Что касается вакцины Синфлорикс, она официально показана для предотвращения пневмококковых инфекций, обусловленных серотипом 19А. Не вызывает сомнений, что она способна обеспечить защиту против инфекций, которые вызывает серотип 6А. Конкурентный препарат содержит серотип 3, но защита против 3 серотипа не обеспечивается в той же мере, как и против других серотипов. Это связано с биологическими особенностями возбудителя.

В целом, вакцинация против пневмококковой и ротавирусной инфекций может оказать колоссальное влияние на состояние общественного здоровья. Когда я пришел руководить отделением детских инфекций в университете Сан Паулу, там было 60 коек для пациентов с кишечными инфекциями и 100 коек для пациентов с респираторными инфекциями. С тех пор прошло почти 30 лет. Благодаря тому, что программа вакцинации в Бразилии была очень успешной, эти койки стали не нужны.

- Насколько актуальны инфекции, вызванные названными серотипами для Казахстана, то есть как оценить эффективность вакцины?

- Мы пропагандируем подход, который был положен в основу обзора IVAC, подготовленного Университетом Джона Хопкинса и школой общественного здравоохранения Блумберга в США, в подготовке которого приняли участие эксперты CDC, ВОЗ, Университетского колледжа в Лондоне. Необходима интегральная оценка того, как вакцинация повлияет на показатели госпитализации пациентов с пневмонией, менингитами и другими формами инвазивной пневмококковой инфекции, смертности от этих форм инфекции, и т. д.

- Внедрение вакцины против пневмококковой инфекции в Казахстане началось в 2010 году. Почему решение прийти на казахстанский рынок к GSK пришло именно сейчас, а не семь лет назад, когда вакцина против пневмококковой инфекции закупалась у Pfizer?

- Прежде всего, полномасштабная вакцинация против пневмококковой инфекции в масштабах республики начата в Казахстане несколько лет назад. Исторически разрабатывать вакцины начали примерно одновременно, компания Wyeth, которая впоследствии стала компанией Pfizer, имела 7-валентную пневмококковую вакцину, потом они разработали 13-валентную, а мы создали 10 – валентную вакцину. Многие страны проделали путь от 7-валентной вакцины, к 10- и к 13 - валентной. За последние годы накоплено много новых данных, которые позволяют сделать вывод о том, что 10 – и 13- валентная вакцины демонстрируют сходный профиль эффективности и безопасности. Поэтому выбор вакцины может быть осуществлен в рамках открытого, прозрачного и справедливого тендера, что позволит существенно снизить стоимость вакцины. Кстати, эти средства могут быть реинвестированы в здравоохранение республики, например, позволят защитить малышей от еще одной инфекции – например, ротавирусной.

- Каких результатов вы ожидаете от прошедших дебатов?

- По результатам дебатов была принята взвешенная резолюция, отражающая прозвучавшие точки зрения. Сейчас в Казахстане происходит то, что происходило во многих странах мира. Когда эксперты представляют данные об эффективности, безопасности и принимается решение, главное - чтобы было принято решение об открытом тендере. Например, в Бельгии была выбрана 10-валентная вакцина Синфлорикс, в Люксембурге - 13-валентная вакцина производства компании Pfizer. Основная задача - это добиться решения о проведении тендера, чтобы руководство государственных агентств и ведомств пошли на равноправную, открытую, прозрачную процедуру.

- Не могли бы Вы привести примеры, какой экономический эффект эта практика проведения открытых тендеров имела других странах?

- Мы понимаем, что если вакцины обладают сравнимой эффективностью при сравнимой цене за дозу препарата, то эффективность затрат сопоставима. Обе вакцины хороши с точки зрения фармакоэкономики. Что касается примеров результатов проведения тендера, то, например, в Марокко на разницу, полученную при проведении открытого тендера удалось внедрить в национальный календарь иммунизации еще одну прививку.

- Во многих странах также остается актуальной проблема недоверия населения к вакцинации. Так, в августе министр здравоохранения РК говорил о возможном введении штрафов для лиц, отказывающихся от вакцинации. Какие меры в мире применяются для того, чтобы население прививалось?

- Что касается мер воздействия, в разных странах применяются разные способы. В Австралии это штрафы, в Бразилии и Калифорнии ограничивают посещение школы непривитыми детьми. В Бразилии также есть другие системы контроля. Например, когда человек устраивается на работу, он должен иметь определенные прививки. В России есть список профессий, где нужна обязательная вакцинация. Но репрессии дают ограниченный эффект. Более сложный, но и более эффективный путь - это равноправный уважительный диалог, который ведет к добровольной, осознанной вакцинации. Один из основных аспектов в решении данной проблемы – это форма и содержание образовательных программ, адресованных и медикам, и населению. Образованный человек сможет принять решение о том, стоит ли ему прививать себя или ребенка и почему.

Читайте "Курсив" там, где вам удобно. Самые актуальные новости из делового мира в Facebook и Telegram

Вакцинация от ПНЕВМОКОККОВОЙ инфекции — Степан Бегларян

Пневмококки — это подвиды стрептококков. Почти все пневмонии и гнойные отиты, а еще половина менингитов вызываются именно пневмококками (Streptococcus pneumoniae).

Пневмококковая инфекция не дает длительного иммунитета. Поэтому те же пневмонии или гнойные отиты могут случаться неоднократно.

Вакцинация от пневмококка — что дает?

Вакцинация против пневмококковой инфекции дает защиту против тех штаммов пневмококков, компоненты которых входят в вакцину.

Продолжительность этой защиты вероятно пожизненная. Почему вероятно? Потому что эти вакцины существуют лишь 20-30 лет, нет людей, вакцинированных от пневмококковой инфекции 50 или 70 лет назад. Например, те же корь и полиомиелит, от которых существует вакцина с середины XX века, подобных вопросов не вызывают. Со временем о продолжительности пневмококкового защиты тоже будем знать.

Но и сейчас, учитывая тип протипневмококовой вакцины (ПКВ) и исследуя поствакцинальный иммунитет после ПКВ, ученые понимают, что защита будет держаться как минимум много-много десятилетий, скорее всего — всю жизнь.

Пневмококковая вакцина и календарь прививок

Пневмококковая вакцина входит в календарь прививок многих стран. Исключениями среди стран Европы являются Украина и Румыния, среди постсоветских стран — Азербайджан и Украина. Почти все страны Америки и Азии тоже вакцинируют свое население против пневмококковой инфекции.

Избавиться от 99% пневмоний, 99% гнойных отитов и половины менингитов — очень хорошая инициатива для любой страны. И большинство государств идут на этот логический шаг.

В Украине планируется добавить вакцинацию против пневмококков в национальный календарь прививок в 2022 году.

Кому можно прививаться против пневмококка?

Пневмококковая вакцина срабатывает с 6-недельного (1,5-месячного) младенческого возраста. Большинство стран, где ПКВ есть в календаре, прививают ее с 2-месячного возраста.

Взрослым — можно. Верхней возрастной границы нет.

Учитывая, что по состоянию на 2020 год вакцинация против пневмококков не входит в украинский календарь прививок, она все же рекомендуется пациентам из групп риска в нормативных прививочных законах. Хотя когда речь идет об инфекциях, думаю, важнее законы природы. Если в какой-то стране отсутствует нормативно-правовая база, а вакцина есть, тогда мы можем либо получить эту защиту, либо ее не получить.

Какие группы риска пневмококковой инфекции?

Во-первых, это пациенты с иммуноскомпрометированными состояниями — дети с первичными иммунодефицитами (врожденные генетические болезни), люди с вторичными иммунодефицитами (ВИЧ/СПИД, прием иммуносупрессивных препаратов при онкозаболеваниях, при некоторых хронических заболеваниях, после трансплантации органов, также состояние после удаления селезенки, почечная недостаточность и другие подобные состояния).

Во-вторых, это пожилой возраст, а также наличие хронических болезней легких и сердца. Например, в условного дедушки пневмония будет протекать тяжелее, также как у молодого пациента с бронхиальной астмой.

Какие существуют вакцины против пневмококков?

Пневмококки, так же как менингококки и гемофильная инфекция, имеют мембрану из полисахаридов. Иммунная система человека, ребенка, до 2 лет практически не распознает эти бактерии. Распознает так поздно, что микроорганизм уже делает свое злое дело.

Полисахаридные пневмококковых вакцины (ППВ) исторически были первым типом вакцин против пневмококковой инфекции. Но эффект их был непродолжительным, всего на несколько лет. Такие вакцины существуют и сейчас, например, поливалентная ППВ-23 (Пневмо-23 против 23 штаммов пневмококков).

Новый тип вакцин, о которых упоминалось выше, которые дают длительную, даже пожизненную защиту, разработаны относительно недавно. В этих вакцинах полисахаридный компонент конъюгирован, то есть связан, с белковым компонентом. Они так и называются — пневмококковых конъюгированные вакцины (ПКВ).

В Украине доступны такие пневмококковые вакцины:

  • Превенар-13 — вакцина ПКВ-13 британского производства, против 13 штаммов пневмококковой инфекции.
  • Синфлорикс — вакцина ПКВ-10 бельгийского производства, против 10 штаммов пневмококковой инфекции.

Превенар-13 или Синфлорикс — что лучше?

Оба препарата рекомендованы ВОЗ как вакцины с идентичной защитой. Да, это неодинаковые вакцины, только 9 штаммов (из 13 и 10) в них совпадают. Поэтому если нужна серия из нескольких прививок (детям младшего возраста), рекомендуется вакцинироваться одной и той же вакциной.

Конечно, 13 штаммов звучит лучше, чем 10. Но учитывая что обе вакцины хорошо покрывают защиту от штаммов пневмококков, распространенных в Европе, и Превенар-13 и Синфлорикс подходят прекрасно. Поэтому выбирать Синфлорикс или Превенар стоит, опираясь более на финансовый компонент выбора и наличие препаратов.

Сколько доз Превенар-13 или Синфлорикс вводить?

Пневмококковая вакцина вводится тем больше раз, чем в меньшем возрасте начать вакцинацию. Пневмококки и менингококки и так опасны для всех детей и взрослых. А в возрасте до 2 лет они опаснее в десятки или сотни раз.

Варианты:

  • Начать ПКВ после 2-месячного возраста — вводить 3 или 4 раза, в зависимости от выбранной схемы.
  • Начать ПКВ после 6-7 месяцев — вводить 3 раза.
  • Начать Синфлорикс от 1 до 5 лет — 2 раза.
  • Начать Превенар-13 от 1 до 2 лет — 2 раза.
  • Превенар-13 от 2 лет и взрослым — однократно.

Свою индивидуальную схему прививок по пневмококковой и других вакцин можно составить с помощью сервиса вакарта — вакцинальная карта.

Какие правила вакцинации против пневмококка?

Пневмококковая вакцина — это инактивированная (неживая) вакцина. Даже если ее вводить себе ежедневно по несколько раз, никакой опасности не будет. Но так делать неэффективно, поскольку для эффекта достаточно от 1 до 3-4 доз в зависимости от возраста (см. выше).

Если у вас нет среднетяжелой или тяжелой болезни, если температура вашего тела ниже 38,0 °C, тогда спокойно идите и вакцинируйтесь.

Побочные реакции после вакцинации
  • Температурная реакция ~ 8-10% случаев, имеет право случаться в течении 3 суток.
  • Местные реакции (покраснение, болезненность, уплотнение) ~ 15-20% случаев.
  • Если побочные эффекты сильнее, чем обычно, все решается приемом ибупрофена или парацетамола по рекомендациям врача.
  • В остальных 70-75% случаях никаких побочных реакций нет.
Мочить можно?

Да, можно. Хоть сразу после вакцинации идти купаться в бассейн. Вода на коже никак не влияет на иммунные реакции.

Также просмотрите:

Вакцинация во время беременности или лактации

Беременность не является противопоказанием к вакцинации неживыми вакцинами, поэтому можно делать, как до или после беременности, так и во время беременности. Грудное вскармливание тоже не противопоказание к вакцинации против пневмококковой инфекции.

Пневмококковая вакцина и гриппозная пневмония

Большинство вирусных пневмоний часто осложняются бактериальной пневмококковой пневмонией. Поэтому вакцины Превенар-13 или Сифлорикс детям, поэтому Превенар-13 взрослым уменьшают риски развития большинства пневмоний. Так же прививки против гриппа и против пневмококка имеют много общего в плане групп риска и рекомендаций.

Пневмококковая вакцина и коронавирус

Во время коронавирусной пандемии COVID-19 (SARS-CoV-2) у пациентов, особенно взрослых, возникает много вопросов.

Уменьшает ли Превенар-13 риски заразиться коронавирусом?

Пневмококковые вакцины уменьшают риски заразиться только пневмококками.

Уменьшает ли Превенар-13 риски перенести коронавирусную пневмонию легче?

Коронавирусная пневмония — это интерстициальная пневмония. В отличие от гриппа, вирусы SARS, MERS и nCoV-2019 вызывают фиброзирование (рубцевание) интерстиция легких, то есть его каркаса. Подобные состояния также называют пневмонит, пульмонит.

Когда развивается эта атипичная пневмония, защита от пневмококковой инфекции вряд ли поможет. Но пневмококковая вакцинация поможет избежать дальнейшего развития бактериального осложнения, вызванного пневмококками.

То есть Превенар-13 поможет не иметь пневмококковой пневмонии и до, и во время, и после заболевания коронавирусом.

Если вы еще не делали пневмококковую вакцинацию себе или ребенку, то после перенесения коронавируса даже без клинических проявлений пневмонии Синфлорикс или Превенар-13 точно не помешают.

Также ознакомтесь с рекомендациями о прививках против менингококков — от этой сташной инфекции также можно защититься.

Степан Бегларян, педиатр, детский иммунолог.

Консультирую на приёме (Киев), а также онлайн.

Разрабатываю иммунологический онлайн-тест
и вакцинальную карту - вакарта.

Контактные данные - обращайтесь.

Похожее

Пятилетний анализ эффективности вакцинации пневмококковой инфекции у пациентов с хронической обструктивной болезнью легких | Игнатова

1. GOLD 2011. Global Strategy for the Diagnosis, Management and Prevention of COPD. Available at: http://gold-copd.org/gold-2011-global-strategy-diagnosis-management-prevention-copd/ [Accessed 05 March, 2018].

2. GOLD 2017. Global Strategy for the Diagnosis, Management and Prevention of COPD. Available at: http://goldcopd.org/gold-2017-global-strategy-diagnosis-management-prevention-copd/ [Accessed 05 March, 2018].

3. Чучалин А.Г., Авдеев С.Н., Айсанов З.Р. и др. Федеральные клинические рекомендации по диагностике и лечению хронической обструктивной болезни легких. 2016. Доступно на: http://spulmo.ru/obrazovatelnye-resursy/federalnye-klinicheskie-rekomendatsii/ [Дата обращения 05.03.18].

4. Рекомендации ESC по диагностике и лечению острой и хронической сердечной недостаточности. 2016. Доступно на: http://www.scardio.ru/rekomendacii/rekomendacii_esc_close/ [Дата обращения 05.03.18].

5. Горяйнов В.А., Каабак М.М., Бабенко Н.Н. и др. Вакцинация пациентов с хронической почечной недостаточностью в пред- и посттрансплантационном периоде. Терапевтический архив. 2015; 87 (12): 32–35. DOI: 10.17116/terarkh3015871232-35.

6. Ciszewski A. Cardioprotective effect of influenza and pneumococcal vaccination in patients with cardiovascular diseases. Vaccine. 2018; 36 (2): 202–206. DOI: 10.1016/j.vaccine.2017.11.078.

7. Игнатова Г.Л., Антонов В.Н. Влияние вакцинации на динамику бронхиального и системного воспаления у пациентов с хронической обструктивной болезнью легких и ишемической болезнью сердца. Терапевтический архив. 2017; 89 (3): 29–33. DOI: 10.17116/terarkh301789329-33.

8. Игнатова Г.Л., Антонов В.Н. Эпидемиологические особенности хронической респираторной патологии при вакцинации против пневмококковой инфекции. Пульмонология. 2017; 27 (3): 376–383. DOI: 10.18093/0869-0189-2017-27-3-376-383.

9. Hoshi S.L., Kondo M., Okubo I. Economic evaluation of immunisation programme of 23-Valent Pneumococcal Polysaccharide vaccine and the Inclusion of 13-Valent Pneumococcal Conjugate vaccine in the list for single-dose subsidy to the elderly in Japan. PLoS One. 2015; 10 (10): e0139140. DOI: 10.1371/journal.pone.0139140.

10. Wasserman M., Sings H.L., Jones D. et.al. Review of vaccine effectiveness assumptions used in economic evaluations of infant pneumococcal conjugate vaccine. Expert Rev. Vaccines. 2018; 17 (1): 71–78. DOI: 10.1080/14760584.2018.1409116.

11. The MRC breathlessness scale addapted from Fletcher C.M. Discussion on the diagnosis of pulmonary emphysema. J. Proc. R. Soc. Med. 1952; 45 (9): 576–586.

12. ATS Committee on proficiency standards for clinical pulmonary function laboratories. Am. J. Respir. Crit. Care Med. 2002; 166 (1): 111–117. DOI: 10.1164/ajrccm.166.1.at1102.

Прививка Превенар 13 пневмококковая, цена, схема вакцинации детей и взрослых, состав вакцины

Согласно инструкции, вводится однократно.

Детям первых лет жизни прививки проводят в верхне-наружную поверхность средней трети бедра, лицам старше 2-х лет – в дельтовидную мышцу плеча.

В возрасте начала вакцинации 2-6 мес. схема вакцинации 3+1 или 2+1, индивидуальная иммунизация 3 дозы с интервалом не менее 4 нед. м/у введениями. Первую дозу можно вводить с 1-х мес. Ревакцинация однократно в 11-15 мес. Массовая иммунизация детей: 2 дозы с интервалом не менее 8 нед. между введениями. Ревакцинация однократно в 11-15 мес.

В возрасте начала вакцинации 7-11 мес. схема вакцинации 2+1, 2 дозы с интервалом не менее 4 нед. м/у введениями. Ревакцинация однократно на втором году жизни.

В возрасте начала вакцинации 12-23 мес. схема вакцинации 1+1, 2 дозы с интервалом не менее 8 нед. м/у введениями.

В возрасте начала вакцинации 2 года и старше схема вакцинации — 1 доза ожнократно.

ВОЗ, международными медицинскими агентствами и российскими экспертами рекомендованы следующие схемы пневмококковой вакцинации взрослых:

Лицам 18–64 лет из групп риска, не имеющим иммунокомпрометирующих состояний, рекомендуется ведение 1 дозы ППВ23* без ревакцинации.

Лицам 18–50 лет из групп риска при наличии иммунокомпрометирующих состояний рекомендуется вакцинация ППВ23 и последующая ревакцинация ППВ23 через 5 лет после первой дозы.

Лицам старше 50 лет и без ограничения возраста при наличии иммунокомпрометирующих состояний рекомендуется однократная вакцинация «ПКВ13**, однократная вакцинация ППВ23 и ревакцинация ППВ23 через 5 лет после 1-й дозы ППВ23.

Лицам старше 65 лет, как здоровым, так и из групп риска, рекомендуется однократная вакцинация ПКВ13и однократная вакцинация ППВ23. При наличии иммунокомпрометирующих состояний таким лицам рекомендуется также ревакцинация ППВ23 через 5 лет после 1-й дозы ППВ23.

Последовательность введения ПКВ13 и ППВ23 и интервалы между ПКВ13 и ППВ23
Если пациент, которому рекомендована вакцинация ПКВ13 + ППВ23, ранее не был привит против пневмококковой инфекции, то его рекомендуется привить сначала ПКВ13, а затем с интервалом не менее 8 нед. вводить ППВ23. Если такой пациент получил сначала ППВ23, то вакцинация ПКВ13 проводится не ранее, чем через 1 год после ППВ23. Если пациенту показана ревакцинация ППВ23, то она проводится не ранее, чем через 5 лет после предыдущего введения ППВ23, и не ранее чем через 6–12 мес. после ПКВ13.

* ППВ23 – 23-валентная полисахаридная пневмококковая вакцина
**ПКВ13 – конъюгированная пневмококковая 13-валентная вакцина

Минздрав КР дает разъяснения по поводу вакцинации от пневмококковой инфекции - VESTI.KG

Основная группа, страдающая от пневмококковой инфекции вплоть до летального исхода – дети в возрасте младше 5 лет


По оценкам ВОЗ, в мире более 500 тысяч детей в возрасте младше 5 лет ежегодно умирают от пневмококковых заболеваний. Летальность при пневмококковых пневмониях может достигать -20%, при менингитах – 50%.

Пневмококковая инфекция — группа заболеваний, вызываемая бактериями - пневмококками. Заболевания, вызываемые пневмококками, включают в себя:
-тяжелые заболевания: пневмония, менингит и бактериемия (наличие бактерий в крови) и  более легкие заболевания, такие как воспаление среднего уха (отит среднего уха), синусит и бронхит.

Как передаётся пневмококковая инфекция? Пневмококки передаются при непосредственном контакте с выделениями из дыхательных путей заболевших лиц и здоровых носителей пневмококков.

Пути передачи пневмококковой инфекции: воздушно-капельный, контактно-бытовой.

Может ли организм ребенка самостоятельно бороться с инфекциями? Иммунная система малышей, на которую возложена защита от всех чужеродных агентов, склонна к генерализации любой инфекции и часто не в состоянии с ними справиться.

Именно поэтому мы стараемся защитить наших детей с помощью прививок.

Что такое вакцины? Как правило, многие современные  вакцинные препараты, в т.ч. и вакцины, не содержат цельных микроорганизмов. В  их составе только активные компоненты, обеспечивающие формирование невосприимчивости к определенным инфекционным заболеваниям за счет выработки к их возбудителям специфичных антител и клеток памяти.

Таким образом, при введении вакцин в организм мы «знакомим» его со структурой возбудителя инфекции и «обучаем» методам борьбы с ними. Когда наш организм встречается с настоящим возбудителем, выработанная им защита (иммунитет) препятствуют развитию заболевания или облегчает его течение.

Иммунная система способна одновременно обрабатывать тысячи антигенов без ущерба для здоровья. Поэтому проведение в один день прививок против различных инфекций безопасно и  позволяет создать против них прочный иммунитет. Помимо этого, использование современных комплексных вакцин уменьшает количество инъекций и снижает вероятность психологической травмы ребенка.

Какая вакцина будет использоваться для вакцинации против пневмококка  в КР?

ПКВ 13 - это пневмококковая полисахаридная конъюгированная вакцина, которая содержит сахара (полисахариды) наружной капсулы бактерий Streptococcus pneumonia. Вакцина  защищает от 13 серотипов пневмококка. Она не содержит никаких животных компонентов.

Для чего делается ПКВ? Дети первого года жизни более  подвержены высокому риску заболеваний  пневмококковой инфекцией. Эта вакцина предохраняет от тяжелых форм пневмококковых заболеваний.

В первую очередь должны быть привиты ослабленные дети, лица с хроническими заболеваниями. Где производится данная вакцина?

ПКВ 13 выпускает компания Pfizer Limited Sandwich, совместный производитель США, Франция и  Бельгия. ПРЕВЕНАР® 13 производится в соответствии с рекомендациями ВОЗ по производству и контролю качества пневмококковых конъюгированных вакцин.

Безопасна ли данная вакцина? Вакцина против пневмококковой инфекции безопасна и отвечает всем международным стандартам качества и хорошо переносится. Тяжелые нежелательные реакции, связанные с вакциной, развиваются чрезвычайно редко.

Какие могут быть реакции на прививку? Любая прививка может дать вакцинальную реакцию - болезненность, уплотнение на месте укола, покраснение и незначительное повышение температуры тела, которая не требует специального лечения и проходит самостоятельно.

В каком возрасте вводится данная вакцина? Согласно  календарю профилактических прививок КР, вакцинация ПКВ 13  проводится трёхкратно в возрасте  2,  5  и 12 месяцев.

Вакцина  имеет противопоказания?

-Повышенная температура тела;

-Острые заболевания;

-Обострение хронических заболеваний;

-Острая аллергическая реакция на ранее проводимые вакцинации.

Прививка против пневмококковой инфекции откладывается до выздоровления.

Проконсультируйтесь с медицинским работником, если у вас есть сомнения или вопросы по противопоказаниям.  

В каких странах используется ПКВ?

Вакцинация против пневмококковой  инфекции проводится в 94 странах мира. Самый большой опыт использования вакцины против пневмококковой инфекции в США с 1980 года. Страны Европейского союза, Королевство Саудовской Аравии, Объединённые Арабские Эмираты, Турция  и многие другие страны используют данную вакцину более десяти лет. В  Казахстане -  с 2011 года, в России - с 2013 года, в Таджикистане и Узбекистане -  с 2015 года.

Как быть, если  ребенок  уже перенес пневмонию?

Ребёнка прививать надо, так как  неизвестно, каким возбудителем было вызвано данное заболевание.

Нужно ли взрослым делать прививку?

Взрослые могут получать вакцинацию от пневмококковой  инфекции только по эпидпоказаниям.

Вакцинация проводится бесплатно?

Согласно закону Кыргызской Республики «Об иммунопрофилактике инфекционных болезней»:  гражданам КР проводится вакцинация бесплатно.  

Пресс-служба Минздрава КР
Фото www


Охват вакцинацией детей можно оценить на основе данных медицинского страхования

BMC Public Health. 2008; 8: 82.

, 1 , 2 , 3 , 2 и 1

Хелен Калиес

1 Институт социальной педиатрии и подростковой медицины, Мюнхен, Германия

Rebekka

2 Kassenärztliche Vereinigung Bayerns, Мюнхен, Германия

Рудольф Варга

3 AOK Bayern - Die Gesundheitskasse, Мюнхен, Германия

Мартин Таушер Байернс

2 в Мюнхене Kries

1 Институт социальной педиатрии и подростковой медицины, Мюнхен, Германия

1 Институт социальной педиатрии и подростковой медицины, Мюнхен, Германия

2 Kassenärztliche Vereinigung Bayerns, Мюнхен

АОК Бавария - Die Gesundheitskasse, Мюнхен, Германия

Автор, ответственный за переписку.

Поступило 19 июня 2007 г .; Принято 1 марта 2008 г.

Авторские права © 2008 Kalies et al; лицензиат BioMed Central Ltd.

Это статья в открытом доступе, распространяемая в соответствии с условиями лицензии Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), которая разрешает неограниченное использование, распространение и воспроизведение на любом носителе. при условии правильного цитирования оригинала.

Эта статья цитируется в других статьях в PMC.

Abstract

Предпосылки

Внедрение новых вакцин для детей младшего возраста требует инструментов для быстрой и своевременной оценки постепенно увеличивающегося охвата вакцинацией.Мы оценили, можно ли использовать стандартные данные, полученные государственным медицинским страхованием (SHI), для мониторинга охвата вакцинацией детей младшего возраста.

Методы

Для 90% населения система здравоохранения Германии финансируется за счет страховых взносов через SHI. Для выставления счетов используются специальные медицинские коды вакцинации детей. Они использовались для анализа вакцинации детей в возрасте до 24 месяцев, родившихся в Баварии в период с 2001–10–01 и 2002–12–31. Для детей, застрахованных в крупнейшем ОМС, оценки охвата вакцинацией, основанные на данных выставления счетов, сравнивались с оценками, учитывающими только постоянно застрахованных детей с рождения, на основе дополнительных данных, предоставленных этим ОМС.

Результаты

Определение подходящего знаменателя на основе данных биллинга было серьезной проблемой: определение знаменателя с помощью любой консультации с детьми с разными идентификационными номерами дало 196 732 ребенка, что в 1,4 раза превышает количество рождений в Баварии. Основными причинами такого завышенного знаменателя были миграция и изменение номера медицинской страховки. Сокращенный набор данных, основанный на как минимум одном посещении врача в течение первых шести месяцев и 2-го года жизни, дал 111 977 детей.Оценки охвата вакцинацией детей в крупнейшем ОМС были максимум на 1,7% выше, чем в наборе данных, основанном на постоянно застрахованных детях.

Заключение

С соответствующими корректировками для определения знаменателя данные о счетах для врачей представляют собой многообещающий инструмент для оценки охвата иммунизацией. Небольшое завышение этих данных объясняется тем, что дети никогда не обращались к врачу.

История вопроса

Стратегический план Европейского региона ВОЗ направлен не только на достижение высоких уровней детской иммунизации, но и на обеспечение максимальной защиты в самом раннем возрасте и сокращение географических различий в охвате вакцинацией [1].Несмотря на то, что Германия признала эти цели, в этой стране один из самых низких уровней охвата вакцинацией в Европе [2], введение всех рекомендованных вакцин детям значительно задерживается, и существует большая географическая разница между ее 16 штатами (например, диапазон за 1 -ю дозу противокоревой иммунизации через 2 года: 58 - 88%) [3].

Несмотря на признание необходимости создания системы мониторинга полноты и своевременности иммунизации, во многих странах реестры таких данных отсутствуют [4,5].Поэтому оценка охвата вакцинацией в большинстве стран основана либо на специальных обследованиях репрезентативных выборок, либо на оценке во время школьных медицинских осмотров, либо на обоих [6-8]. Несмотря на несомненную полезность этих данных в отсутствие лучших источников, они имеют ряд ограничений: опросы чреваты проблемами, касающимися полноты, размера выборки, репрезентативности и огромных затрат, а школьные медосмотры отстают от текущей практики вакцинации на 5-6 лет и не оценивайте типы вакцин или время вакцинации.

В таких странах, как Германия, Франция и США, иммунизация детей в основном проводится частным сектором (педиатры и врачи общей практики) [4,9]. Хотя этим врачам платят за вакцинацию, данные о расходах, связанных с вакцинацией, не использовались для систематической оценки охвата вакцинацией.

В когорте детей, родившихся между 2001–10–01 и 2002–12–31 в Баварии, втором по плотности населения немецком государстве, мы поэтому оценили, могут ли такие данные о введении вакцины быть полезными для отображения внедрения вакцины в возрастной группе. 24 мес.

Методы

Система медицинского страхования и Ассоциация врачей медицинского страхования в Германии

Система здравоохранения Германии финансируется за счет взносов за счет обязательного медицинского страхования (ОСМС) для 90% населения. В рамках SHI в Германии около 115 000 врачей предоставляют амбулаторные услуги. SHI оплачивает услуги амбулаторных врачей через региональные ассоциации врачей SHI, которые обрабатывают всю платежную информацию на индивидуальной основе. Для выставления счетов пациентам амбулаторные врачи обязаны быть членами регионального отделения Kassenärztliche Vereinigung (KV).Для оплаты врачи выставляют электронные счета на основании медицинских кодов за каждое посещение КВ. Любые контакты врачей и профилактические меры, такие как вакцинация, могут быть идентифицированы на основе определенного медицинского кода. В каждом из 16 земель Германии есть как минимум один региональный КВ. Данные баварского KV (KVB) позволяют идентифицировать различные вакцинные антигены, вводимые при посещениях вакцины с июля 2001 года.

Пациенты и установка

Использовались данные KVB. Бавария является крупнейшим (70,552 км, 2 ) и вторым по численности населения государством Германии с 12 миллионами жителей [10].Мы проанализировали консультации врачей и истории вакцинации детей, рожденных между 2001–10–01 и 2002–12–31, с последующим наблюдением до 2004–12–31, что позволило проанализировать любые счета для этих детей в возрасте до 20 лет. минимум 24 месяца.

Характер и структура данных

KVB предоставил данные обо всех консультациях пациентов, за которые врачи амбулаторно выставляли счета на ежеквартальной основе. У каждого пациента есть уникальный идентификационный код в его SHI. Это может измениться, если пациент изменит SHI, что действительно происходит из-за конкуренции между SHI.Таким образом, история вакцинации ребенка полностью отображается в данных биллинга, если только ребенок не перейдет на другую программу медицинского страхования или к врачу за пределами Баварии в течение периода наблюдения. Для статистического анализа набора данных KVB были доступны следующие данные: идентификационный код, член крупной медицинской страховой компании Баварии (AOK Bavaria; да / нет), дата рождения ребенка, дата консультации и - если вакцинация - 4–5-значные коды, идентифицирующие введенные вакцины, или консультации по любой другой причине за квартльный год.

Анализ данных

Для расчета охвата вакцинацией необходимо знать количество вакцинированных детей (числитель) и общее количество детей, имеющих право на вакцинацию (знаменатель). В то время как данные числителя непосредственно предоставляются в наборе данных KVB, соответствующий знаменатель должен быть получен из данных KVB. Ребенок, не консультирующийся с баварским амбулаторным врачом или не застрахованный в SHI, не будет отображаться в данных KVB. Простой подход к оценке количества детей, имеющих право на вакцинацию в рамках SHI, - это рассмотреть всех детей с любым счетом врача до 2004–12–31 (исходный набор данных KVB).Этот подход не принимает во внимание следующие события цензуры: (а) дети, мигрирующие из или в Баварию; (б) дети, которых лечил баварский врач во время каникул и, следовательно, покидают или переходят под ответственность KVB; (c) дети меняются между разными ОМС или между частной медицинской страховкой и ОМС. Масштабы этих проблем и их влияние на оценки охвата вакцинацией были неизвестны. Поэтому мы сравнили два набора данных: (1) исходный набор данных KVB, состоящий из всех детей, по крайней мере, одного посещения врача в течение определенного периода наблюдения; и (2) сокращенный набор данных KVB, применяющий простой алгоритм, который ограничивает исходный набор данных когортой детей, посещающих не менее двух врачей, независимо от его медицинского характера.

Проверка

Число детей в двух наборах данных KVB для баварской когорты рожденных с 2001–10–01 по 2002–12–31 сравнивается с официальными числами, предоставленными Баварским статистическим бюро [10], и различия будут быть проанализированы.

Охват вакцинацией оценивается как для исходного, так и для сокращенного набора данных KVB. Кроме того, чтобы проверить, действительна ли стратегия сокращения набора данных KVB, была получена дополнительная информация от одной страховой компании Баварии (AOK).Цель состояла в том, чтобы определить популяцию, которая постоянно застраховывалась одним ОМС в течение периода наблюдения. АОК Бавария предоставило данные обо всех детях, родившихся в период с 2001–10–01 и 2002–12–31, которые постоянно застрахованы в АОК Бавария с рождения до 2004–12–31. Были доступны следующие данные: идентификационный код, дата рождения ребенка, дата вступления в страховку и выхода из нее. Историю вакцинации детей в наборе данных AOK можно получить, связав идентификационный номер AOK с идентификационным номером для детей, застрахованных AOK, в наборе данных KVB.Оценки охвата вакцинацией детей, постоянно застрахованных в AOK Bavaria, сравниваются с оценками из сокращенного набора данных KVB только для детей, застрахованных AOK.

Определения вакцинационного статуса

Согласно немецкому календарю вакцинации [11] мы определили ребенка как «полностью примированного», если он или она получили не менее трех доз вакцины, содержащей бесклеточные компоненты коклюша, или две дозы вакцины, не содержащей бесклеточные компоненты коклюша. Ребенок считался «полностью иммунизированным», если он или он получил бустерную дозу в возрасте 11 месяцев или позже после полного примирования.В соответствии с приведенными выше определениями мы оценили охват следующих комбинированных серий: первая доза, полная прайминг и полная иммунизация против дифтерии, столбняка, коклюша, полиомиелита, Haemophilus influenzae типа b и гепатита B; первая доза против кори, эпидемического паротита и краснухи (MMR) [7]. Количество иммунизаций и время иммунизации по возрасту в месяцах рассчитывали в соответствии с методом Каплана-Мейера, который подробно описан Laubereau et al. [12].

Все данные, предоставленные KVB и проанализированные в Институте социальной педиатрии и подростковой медицины, Мюнхен, были полностью анонимными в соответствии с немецкими законами о защите данных.

Результаты

Исходный набор данных KVB дает данные о 196 732 детях, родившихся между 2001–10–01 и 2002–12–31. Это больше, чем соответствующее количество детей, родившихся в Баварии за период наблюдения (n = 142 809) [10]. Завышенный знаменатель можно объяснить тем, что (1) дети мигрируют в Баварию или консультируются с баварским врачом во время отпуска и (2) дети меняют страховые компании; эти дети будут записаны более одного раза из-за изменения страховых номеров.Время этих событий цензуры не записывается в наборах данных KVB и поэтому не может учитываться при анализе. Чтобы решить эту проблему, мы уменьшили исходный набор данных KVB. Поскольку нас интересовало использование вакцины в первые два года жизни, нам потребовалось одно посещение в первой половине жизни и одно - на втором году жизни - чтобы убедиться, что эта выявленная когорта наблюдалась до второго года жизни. жизни. Этот алгоритм дал набор данных с 111 799 детьми, что соответствует 78% всех детей, родившихся в Баварии за период наблюдения.

Когорта сокращенного набора данных KVB меньше, чем соответствующие когорты рождения, определенные официальными данными [10]. Разница в количестве детей в сокращенном наборе данных по сравнению с соответствующей баварской когортой рождения, а также величина различных причин показаны в таблице: (1) дети, которые имеют частную страховку, не могут появиться в наборе данных KVB, (2) дети, которые страхование изменений и, следовательно, не может быть отслежено, не появится в сокращенном наборе данных, (3) дети, которые никогда не консультировались амбулаторным врачом или не консультировались амбулаторным врачом в первые шесть месяцев и на втором году жизни, не будут отображаться сокращенный набор данных, и (4) дети, которые переезжают из Баварии.

Таблица 1

Уменьшенный набор данных KVB по сравнению с соответствующими баварскими когортами рождения и причины наблюдаемых различий.

V 111,977 частный 9010
процентов N
Баварские когорты по рождению (1.10.2001–31.12.2002) [9] 100 100

разница 30,832

Причины:
14,281
изменение страховки * 5,0–8,0 7,140–11,425
отсутствие консультации врача амбулаторного отделения в течение 1 st 6 месяцев и 2 nd
45
года жизни * 6998
переезд из Баварии [9] 1,4 1,999

Число детей в проверяемом наборе данных AOK составляло 40 645. 95,1% детей в наборе данных для валидации посещали амбулаторного врача в первые шесть месяцев жизни и на втором году жизни, что и было алгоритмом для создания сокращенного набора данных KVB из исходного набора данных KVB.Доля детей, не обращавшихся к врачу в оба периода, составила 3,1%, доля детей, никогда не посещавших врача, составила 1,8%.

Уменьшенный набор данных KVB о детях, застрахованных AOK (n = 44 755), однако, был даже больше, чем количество детей в предоставленном наборе данных AOK; это объясняется детьми в сокращенном наборе данных KVB с хотя бы одним посещением врача на втором году жизни, которые могли покинуть AOK до 2004–12–31 годов, тогда как набор данных проверки требовал, чтобы все дети были постоянно застрахованы от рождения до 2004– 12–31.

В таблице показаны точечные оценки охвата вакцинацией с 95% доверительным интервалом, полученные из четырех различных наборов данных: исходный и сокращенный набор данных KVB; подмножество сокращенного набора данных KVB, которое включает только детей, застрахованных AOK; и набор данных для детей, постоянно застрахованных в AOK (набор данных для проверки). Оценки охвата вакцинацией сокращенного набора данных KVB были ниже, чем оценки для исходного набора данных KVB. Сокращенный набор данных KVB о детях, застрахованных AOK, и набор данных валидации AOK указывают на несколько более высокие оценки охвата вакцинацией детей, застрахованных AOK.В сокращенном наборе данных KVB по застрахованным детям АОК Бавария оценки охвата вакцинацией были на 1,7% выше, чем оценки для набора данных проверки АОК с дизъюнктивными 95% -ными доверительными интервалами.

Таблица 2

Сравнение оценок охвата вакцинацией (%; 95% ДИ) между двумя наборами данных KVB, набором данных для застрахованных AOK детей в сокращенной когорте KVB и набором данных валидации для двух разных прививок в разном возрасте детей.

вложенного набора данных ABB (только для сокращенного набора данных KVARA 90
Охват вакцинацией (%)

4 9014 9014 9014 9014 9014 9014 9014 9014 9014 9014 9014 9014 9014 901 9014 9014 9014 9014 901 9014 9014 9014 9014 901 9014 901 9014 Набор N MMR 1 st доза через 2 года 1 st доза через 3 месяца Полная праймированная через 1 год Полная иммунизация через 2 года
Исходный набор данных KVB 196,732 60.4 14,6 45,7 40,4
60,2–60,7 ​​ 14,4–14,8 45,5–45,9 40,2–40,7 22,3 67,5 56,0
75,1–75,6 22,1–22,6 67,0–67,6 55,7–56,3
в подмножестве ) 44,755 77.2 24,1 70,5 57,7
76,8–77,6 23,7–24,5 70,1–71,0 57,3–58,2 23,1 68,8 56,6
75,5–76,4 22,7–23,5 68,3–69,2 56,1–57,1
первый и второй момент времени и MM На рис. Иммунизация по возрасту с использованием обратных кривых Каплана-Мейера показана в зависимости от возраста, рекомендованного Постоянным комитетом Германии по вакцинации [11].

Оценки коваража вакцинации для MMR, полученные из сокращенного набора данных KVB. Обратные кривые Каплана-Мейера (95% ДИ), показывающие долю детей, вакцинированных по возрасту ребенка при первой (слева) или второй (справа) вакцинации MMR. Заштрихованные области обозначают рекомендуемый возраст для соответствующей дозы.

Обсуждение

Эти данные из Баварии показывают, что использование стандартных данных, генерируемых SHI для обработки счетов врачей, может стать полезным инструментом для оценки охвата иммунизацией в первые два года жизни в Германии.

Основная проблема при использовании рутинных данных, генерируемых SHI, для обработки счетов врачей состоит в том, чтобы определить соответствующий знаменатель. Рассмотрение всех различных страховых номеров, связанных с выставлением счетов врачом, в качестве суррогата количества детей, имеющих право на вакцинацию (исходный набор данных KVB), приведет к огромному завышению знаменателя и, следовательно, к недооценке оценок охвата вакцинацией.

Ограничение для детей по крайней мере с двумя посещениями - одно в первые шесть месяцев и одно на втором году жизни - сокращает исходный набор данных до 78% от размера баварской когорты рожденных.Влияние этого алгоритма можно было оценить с помощью набора данных проверки AOK: только 3,1% всех детей не посещали амбулаторного врача в эти два периода. Высокая доля детей, осматриваемых врачом в первые два года жизни, может быть следствием бесплатных посещений детского медицинского осмотра в первые два года (U1-U7) с соблюдением режима лечения от 80% до 90%. каждое обследование [13].

Оценки охвата вакцинацией для сокращенного набора данных KVB по детям, застрахованным AOK, дали такие же оценки охвата вакцинацией, как и для набора данных проверки AOK.Однако они были на 1,7% выше, чем для набора данных проверки AOK. Такое систематическое завышение охвата вакцинацией на основе данных KVB можно объяснить тем, что дети никогда не консультировались с амбулаторным врачом - около 1,8% детей в наборе данных валидации AOK. Эти дети не будут вакцинированы, и, поскольку они не включены в знаменатель сокращенного набора данных KVB, охват вакцинацией немного завышен в сокращенном наборе данных KVB. Можно утверждать, что оценка охвата вакцинацией ограничивается приложением.30% детей в Баварии застрахованы AOK. К сожалению, такие данные обычно не доступны - они были получены по специальному запросу для этого исследования.

Представленные здесь оценки охвата вакцинацией не основаны на всей баварской когорте новорожденных. В таблице причины пропуска 22% были правдоподобно объяснены. Однако нет данных, позволяющих предположить, что охват вакцинацией детей в семьях, переезжающих из Баварии, и тех, кто меняет ОМС, должен отличаться от охвата всей когорты.Охват вакцинацией детей, застрахованных в частном порядке, может отличаться, поскольку эти дети происходят из семей, освобожденных от системы медицинского страхования, поскольку доход их родителей превышает определенный порог. Однако направление возможного предвзятого отношения к охвату вакцинацией в этой подгруппе трудно оценить: хотя родители с преимущественно более высоким уровнем образования могут быть более осторожными, чтобы вовремя вакцинировать своих детей, эта клиентура также включает родителей, которых привлекает `` альтернативная '' медицина. кто неохотно относится к вакцинации.

Оценки охвата вакцинацией, полученные на основе данных счетов для детей, застрахованных в рамках программы SHI, позволяют изобразить потребление вакцины как переменную, зависящую от времени. Как в качестве примера показано на рисунке, вакцинация MMR имеет не только низкий охват в возрасте 24 месяцев, но также существует значительная задержка в ее проведении: в конце рекомендуемого возраста (15 и 24 месяца для первой и второй дозы). соответственно) менее 50% детей были вакцинированы соответствующей дозой.Аналогичная картина наблюдается для всех других обычно рекомендуемых вакцин (данные не показаны). Сравнительно низкие и отсроченные оценки охвата вакцинацией детей раннего возраста показали национальное обследование иммунизации [3], но при ограничении этих данных баварскими детьми получаются только чрезвычайно широкие доверительные интервалы.

Заключение

Описанное использование данных счетов СМС для оценки охвата вакцинацией представляется многообещающим подходом с низкими затратами в странах, где вакцинация проводится частным сектором.Размер систематической переоценки охвата вакцинацией из-за того, что дети никогда не обращались к амбулаторному врачу и, следовательно, не появлялись в наборах данных, основанных на данных биллинга, оказался небольшим. Этот источник данных может предоставить полезный инструмент для быстрой оценки прогрессивного увеличения вакцинации новыми вакцинами.

Конкурирующие интересы

Автор (ы) заявляют, что у них нет конкурирующих интересов.

Вклад авторов

HK координировал и спланировал исследование, проанализировал и интерпретировал данные, составил рукопись

RR проанализировал часть данных и критически отредактировал рукопись на предмет важного интеллектуального содержания

RV критически отредактировал рукопись с точки зрения важности интеллектуальной content

MT проанализировал часть данных и критически отредактировал рукопись на предмет важного интеллектуального содержания

RvK внес существенный вклад в концепцию и дизайн исследования и критически отредактировал рукопись на предмет важности интеллектуального содержания

Все авторы прочитали и одобрили окончательную рукопись

Благодарности

Мы хотели бы поблагодарить Dr.Кристиан Тиме, д-р Аксель Мунте (Kassenärztliche Vereinigung Bayerns), Франц Бахль и д-р Гельмут Платцер (AOK Bayern - Die Gesundheitskasse), которые способствовали этому проекту, и д-р Ришела Фишер (Институт социальной педиатрии и подростковой медицины), которая участвовала в планирование и зачатие в начале этого исследования. Этот пилотный проект получил финансовую поддержку Bayerische Staatsministerium für Umwelt, Gesundheit und Verbraucherschutz.

Список литературы

  • Европейское региональное бюро Всемирной организации здравоохранения Болезни, предупреждаемые с помощью вакцин, и иммунизация.2005. http://www.who.dk/vaccine (по состоянию на 3 августа 2005 г.)
  • Reiter S. Ausgewählte Daten zum Impf- und Immunstatus в Германии. Bundesgesundheitsblatt. 2004. 47: 1144–1150. DOI: 10.1007 / s00103-004-0952-у. [PubMed] [CrossRef] [Google Scholar]
  • Калиес Х., Гроте В., Шмитт Х.-Дж., Фон Крис Р. Иммунизационный статус детей в Германии: временные тенденции и региональные различия. Европейский журнал педиатрии. 2006; 165: 30–36. DOI: 10.1007 / s00431-005-1758-0. [PubMed] [CrossRef] [Google Scholar]
  • Герен Н., Рур К.Охват иммунизацией в Европейском Союзе. Euro Surveill. 1997; 2: 2–4. [PubMed] [Google Scholar]
  • Фриман В.А., ДеФриз Г.Х. Проблема и потенциал регистров иммунизации детей. Энн Рев Общественное здравоохранение. 2003. 24: 227–46. DOI: 10.1146 / annurev.publhealth.24.100901.140831. [PubMed] [CrossRef] [Google Scholar]
  • Зелл Э.Р., Эззати-Райс TM, Батталья депутат, Райт РА. Национальное обследование иммунизации: методология системы эпиднадзора за вакцинацией. Отчеты об общественном здравоохранении. 2000; 115: 65–77.DOI: 10,1093 / phr / 115.1.65. [Бесплатная статья PMC] [PubMed] [CrossRef] [Google Scholar]
  • Калиес Х., Гроте В., Шмитт Х.-Дж., Фон Крис Р. Иммунизационный статус детей в Германии: временные тенденции и региональные различия. Европейский журнал педиатрии. 2006; 165: 30–36. DOI: 10.1007 / s00431-005-1758-0. [PubMed] [CrossRef] [Google Scholar]
  • Santoli JM, Huet NJ, Smith PJ, Barker LE, Rodewald LE, Inkelas M, Olson LM, Halfon N. Страховой статус и покрытие вакцинацией детей дошкольного возраста в США.Педиатрия. 2004. 113: 1959–64. [PubMed] [Google Scholar]
  • Reiter S, Rasch G. In: Gesundheitsberichterstattung des Bundes Heft 1: Schutzimpfungen. Институт Роберта Коха, редактор. Институт Роберта Коха, Берлин; 2004. [Google Scholar]
  • Bayerisches Landesamt für Statistik und Datenverarbeitung. Bevölkerungs- und Wanderungsstatistik. http://www.statistik.bayern.de (доступ 2 февраля 2006 г.)
  • Robert Koch-Institut Empfehlungen der ständigen Impfkommission (STIKO) am Robert Koch-Institut / Stand: Juli 2003.Epidemiol Infect. 2003. 32: 243–260. [Google Scholar]
  • Лауберо Б., Херманн М., Шмитт Х. Дж., Вейл Дж., Фон Крис Р. Обнаружение отсроченных вакцинаций: новый подход к визуализации внедрения вакцины. Epidemiol Infect. 2002. 128: 185–192. DOI: 10.1017 / S0950268801006550. [Бесплатная статья PMC] [PubMed] [CrossRef] [Google Scholar]
  • Роберт Кох-Институт [Охват вакцинацией при школьных медосмотрах в Германии, 2004] Эпидемиологический бюллетень. 2005; 49: 460. (на немецком языке) [Google Scholar]

Вакцинация слизистой оболочки рекомбинантной Lactobacillus casei-Конъюгированный с CTA1 консенсусный матричный белок-2 (sM2) индуцирует широкую защиту от дивергентных подтипов гриппа у мышей BALB / c

Аннотация

В качестве безопасной и эффективной вакцины для слизистых оболочек против патогенных вирусов гриппа мы сконструировали рекомбинантные штаммы Lactobacillus casei , которые экспрессируют консервативный матричный белок 2 с (pgsA-CTA1-sM2 / L.casei ) или без (pgsA-sM2 / L. casei ) субъединицы A1 (CTA1) холерного токсина на поверхности. Поверхностная локализация слитого белка была подтверждена анализами клеточного фракционирования, проточной цитометрией и иммунофлуоресцентной микроскопией. Пероральные и назальные прививки рекомбинантного L. casei мышам приводили к высоким уровням сывороточного иммуноглобулина G (IgG) и IgA слизистой оболочки. Однако конъюгация субъединицы A1 холерного токсина индуцировала более сильные слизистые, гуморальные и клеточно-опосредованные иммунные ответы.В контрольном тесте с 10 MLD 50 A / EM / Korea / W149 / 06 (H5N1), A / Puerto Rico / 8/34 (h2N1), A / Aquatic Bird / Korea / W81 / 2005 (H5N2), Вирусы A / Aquatic bird / Korea / W44 / 2005 (H7N3) и A / Chicken / Korea / 116/2004 (H9N2) рекомбинантный pgsA-CTA1-sM2 / L. casei обеспечивают лучшую защиту от летальных исходов, чем pgsA. -sM2 / L. casei , pgsA / L. casei и PBS у мышей. Эти результаты показывают, что иммунизация слизистой оболочки рекомбинантным L. casei , экспрессирующим на своей поверхности СТА1-конъюгированный белок sM2, является эффективным средством индукции защитных иммунных ответов против различных подтипов гриппа.

Введение

Вакцинация остается наиболее экономичным и эффективным средством против респираторных заболеваний, вызываемых вирусами гриппа [1]. На основе циркулирующих в популяции вирусов разработаны штаммы трехвалентных вакцин, которые используются для защиты от вирусов гриппа [2]. Наиболее приемлемой доступной в настоящее время стратегией является внутримышечное введение инактивированных вакцин, производимых системами производства яиц, которые, хотя и эффективны, имеют ограниченные возможности и гибкость [3].Однако вакцинные штаммы необходимо часто адаптировать к вирусам, циркулирующим по всему миру [4]. Кроме того, уровни антител, индуцированные инактивированной вакциной, снизились на 75% за 8-месячный период [2], [5]. Поэтому альтернативные стратегии для разработки широко защищающих, безопасных и эффективных вакцин против вирусных инфекций гриппа имеют большое значение.

Матричный белок 2 (M2) высоко консервативен среди штаммов вируса гриппа A, что указывает на то, что M2 является привлекательной мишенью для разработки универсальной вакцины [6].В предыдущих исследованиях были разработаны и протестированы различные конструкции вакцины M2, включая рекомбинантную Escherichia coli ( E. coli ), экспрессирующую слитый белок M2, аденовирусные векторы, экспрессирующие белок M2, плазмидную ДНК, кодирующую M2 [7] - [7] - [ 9] и пептиды, кодирующие M2e [11], каждый из которых был способен вызывать защитные иммунные ответы у мышей. Однако недостатком этих вакцин на основе M2 является их низкая иммуногенность; кроме того, большинство из них потребуют внутримышечных инъекций.Поэтому было применено множество стратегий, направленных на повышение иммуногенности вакцин на основе M2, например, слияние M2 с различными молекулами-носителями, такими как белок L вируса папилломы человека [12], гемоцианин лимфы улитки [10] и флагеллин [13]. Кроме того, вакцинация с различными адъювантами и путями введения применялась для оценки их защиты от различных штаммов вирусов гриппа. Мыши, иммунизированные слизистой оболочкой M2 или вирусоподобными частицами (VLP) с адъювантом холерного токсина (CT), продемонстрировали лучшую защиту по сравнению с мышами, подвергнутыми парентеральной иммунизации [14], [15].Однако из-за побочных эффектов CT у людей исследователи попытались идентифицировать нетоксичные субъединицы с адъювантностью, удалив либо субъединицу A, либо субъединицу B [16]. E. coli , экспрессирующая субъединицу холерного токсина A1 (CTA1), слитую с D-фрагментом Staphylococcus aureus , продемонстрировала адъювантные эффекты без какой-либо реактогенности субъединицы A1 в вакцине для слизистых оболочек [6]. Хотя химическая или генетическая конъюгация M2 может не представлять M2 в его нативной тетрамерной форме, внеклеточно доступные антигены, экспрессируемые на поверхности бактерий, лучше распознаются иммунной системой, чем те, которые являются внутриклеточными [17].Таким образом, выбор средства доставки также является важной проблемой для потенциальных вакцин для слизистых оболочек.

Недавно были изучены молочнокислые бактерии (LAB), представляющие антигены вируса гриппа [3], [18], [19]. Для иммунизации слизистых оболочек LAB является более привлекательной системой доставки, чем другие векторы живой вакцины, такие как Shigella, Salmonella и Listeria . [20], [21]. Он считается безопасным и проявляет подобный адъюванту эффект на слизистую оболочку и системный иммунитет [18], [22], [23].Закрепление целевого белка на клеточных поверхностях LAB в первую очередь предназначено для использования в вакцинах для слизистых оболочек. Трансмембранный белок pgsA является одним из комплексов поли-γ-глутаматсинтетазы Bacillus subtilis [17], [24], [25], который является хорошо изученным якорным белком, способным сливать целевой белок со своим С-концом и стабилизировать комплекс, закрепляя его в клеточной мембране. Поскольку sM2 является высококонсервативной и многообещающей мишенью для универсальной вакцины, а CTA1 является сильным адъювантом слизистой оболочки, в этом исследовании мы разработали конструкции с использованием консенсусного гена sM2, восстановленного на основе анализа вирусов гриппа h2N1, H5N1 и H9N2 (без трансмембранного домена ) со слиянием CTA1 или без него.Для этого мы использовали новый вектор экспрессии, который может экспрессировать продукт гена pgsA в качестве якорной матрицы. Наши целевые антигены, sM2 и CTA1, были отображены на поверхности Lactobacillus casei , и пероральное или интраназальное введение рекомбинантного L. casei индуцировало системные иммунные ответы и иммунные ответы слизистых оболочек, которые потенциально могут защитить от смертельных проблем различных подтипы гриппа.

Материалы и методы

Животные, иммунизация слизистой оболочки и вирусные заражения

Всего 672 самки мышей BALB / c (возраст 5 недель) были приобретены у Самтако (Сеул, Корея) и помещены в вентилируемые клетки.Мышей содержали гранулированным кормом и водопроводной водой ad libitum , содержали в среде, свободной от конкретных патогенов, и были предприняты все усилия, чтобы минимизировать страдания после одобрения Институционального комитета по уходу за животными и использованию животных корпорации Bioleaders, Тэджон, Юг. Корея, номер протокола: BSL-ABLS-13-002. Иммунизация животных проводилась в лабораторных помещениях с уровнем биобезопасности (BSL) -2. Мышей разделили на 6 экспериментальных групп, каждая из которых состояла из 2 подгрупп: 1 для перорального и 1 для интраназального введения, каждая из которых содержала 4 группы.Из 6 наборов в 4 наборах было по 14 мышей на группу. Один набор содержал 17 мышей (3 мыши для гистопатологии легких и иммуногистохимии), а последний содержал 11 мышей на группу (3 мыши для ответа CTL).

Концентрации рекомбинантного L. casei определяли по колониеобразующим единицам (КОЕ). В каждой подгруппе 2 группы получали 10 10 КОЕ pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L. casei , а остальные две группы получали одинаковую концентрацию pKV-pgsA / . Л.casei или PBS в 100 мкл перорально с помощью внутрижелудочного лаважа в дни 0–3, 7–9 и 21–23. Аналогичным образом 10 9 КОЕ рекомбинантных клеток вводили в 20 мкл суспензии в ноздри слегка анестезированных мышей в дни. 0–3, 7–9 и 21. Образцы крови собирали из ретроорбитального сплетения на -1, 14 и 28 дни; сыворотки отделяли центрифугированием в течение 5 минут при 12000 × g и хранили при -20 ° C до анализа. На 28 день по 3 мыши в каждой группе случайным образом умерщвляли для сбора образца IgA из легких и кишечника и хранили при -70 ° C до анализа.Селезенки собирали в асептических условиях на 28 день для анализа ответа CTL случайным образом от 3 мышей одной группы. Остальных мышей из той же группы содержали в течение 6 месяцев с даты последней повторной иммунизации для измерения длительных иммунных ответов и эффективности защиты.

Вирусы птичьего гриппа A / EM / Korea / W149 / 06 (H5N1), A / Puerto Rico / 8/34 (h2N1), A / Aquatic bird / Korea / W81 / 2005 (H5N2), A / Aquatic bird / Korea / W44 / 2005 (H7N3) и A / Chicken / Korea / 116/2004 (H9N2), использованные в этом исследовании, были любезно предоставлены доктором.Ён-Ки Чой (Медицинский колледж и Институт медицинских исследований, Национальный университет Чунгбук, Чхонджу, Республика Корея). Все вирусы размножались в аллантоидной жидкости 10-дневных куриных эмбрионов, и 50% летальные дозы мышей (MLD 50 ) были определены у 8-недельных наивных мышей BALB / c. Мышей под эфирным наркозом интраназально инфицировали контрольными вирусами в 10 раз больше MLD 50 в 20 мкл PBS. Шесть мышей в каждой группе были умерщвлены с разрешением 3 и 5 точек на дюйм для проверки титра вируса в легких, а другие 5 мышей, оставшихся в каждой группе, были использованы для выживания.За мышами наблюдали через день в фиксированный момент времени для измерения потери веса и выживаемости. Мышей умерщвляли умерщвлением, т. Е. Потерей веса, взъерошенной шерстью, дрожью, тахипноэ, респираторным дистресс-синдромом, переохлаждением и плохой реакцией на внешние раздражители, оставшиеся считали выживаемостью. После окончательного мониторинга все выжившие мыши были гуманно умерщвлены с помощью ингаляции CO 2 в течение 5 минут.

Через 180 дней после последней вакцинации мышей из одной группы заражали H5N2 для измерения длительных иммунных ответов.Все контрольные тесты проводились на утвержденном объекте BSL-3 + в соответствующих условиях.

Бактериальные штаммы и клонирование для создания рекомбинантной плазмиды PgsA-sM2 /

L. casei и PgsA-CTA1-sM2 / L. casei

В этом исследовании E. coli JM83 использовали для клонирования, а L. casei L525 использовали для поверхностной экспрессии целевого белка. Эти бактерии выращивали в средах LB и MRS соответственно. Плазмиду pKV-Pald-PgsA, несущую гены pgsA Bacillus subtilis , использовали для конструирования плазмиды поверхностного дисплея, которая была любезным подарком от Bioleaders Corporation (Тэджон, Южная Корея).Был получен ген, кодирующий консенсусную последовательность M2, охватывающую остатки внеклеточного и цитоплазматического доменов без трансмембранного домена вируса гриппа. Консенсусные последовательности были созданы на основе наиболее распространенных аминокислот в каждом положении выравнивания h2N1, H5N1 и H9N2; затем они были синтезированы и использованы в качестве матриц для конструирования плазмид pgsA-sM2 / L. casei и pgsA-CTA1-sM2 / L. casei путем клонирования, как описано ранее [26], [27].Ген sM2 был модифицирован путем добавления сайта Kpn I на 5'-конце и Sal I на 3'-конце для клонирования. Полимеразную цепную реакцию (ПЦР) проводили для амплификации гена с использованием пары праймеров 5'-GGGGTACCTCATTATTAACA-3 ' и 5'-ACGTCGACTCATTATTCAAGTTCAATAATG AC-3'. Точно так же сайт Bam HI на 5'-конце и сайт Kpn I на 3'-конце были добавлены к гену CTA1 с использованием праймеров 5'-CGGGATCCAATGATGATAAGTTATAT-3 ' и 5'-GGGCT ACCCGATAGCATGAT АТТ-3 ′ .Модифицированные гены лигировали в вектор T Easy (Invitrogen, Сеул, Корея). Затем гены расщепляли Kpn I- Sal I для sM2 и Bam H I- Kpn I для CTA1. Расщепленный sM2 лигировали с плазмидным вектором pKV-pgsA для конструирования pKV-pgsA-sM2. Точно так же CTA1 лигировали для конструирования pKV-pgsA-CTA1-sM2. Лигированные продукты трансформировали в компетентные клетки E. coli JM83, как описано ранее, с использованием метода электропорации [17].Профили рекомбинантных плазмид были подтверждены расщеплением рестрикционной эндонуклеазой и секвенированием ДНК (Solgent, Сеул, Корея). После подтверждения плазмиды трансформировали в L. casei L525 с помощью электропорации и называли pgsA-sM2 / L. casei и pgsA-CTA1-sM2 / L. casei.

Фракционирование клеток и иммуноблоттинг

Рекомбинантный L. casei , содержащий гены pgsA, pgsA-sM2 и pgsA-CTA1-sM2, выращивали при 30 ° C в течение 48 часов.Клетки собирали центрифугированием при 6000 × g в течение 10 минут при 4 ° C с последующей двукратной промывкой стерильным фосфатно-солевым буфером (PBS). Бактериальный лизис выполняли обработкой ультразвуком и центрифугированием при 12000 × g в течение 20 минут при 4 ° C. Фракции клеточной стенки и цитоплазмы разделяли центрифугированием при 25000 × g при 4 ° C в течение 2 часов. Гранулы (клеточную стенку) ресуспендировали в 100 мкл 1% саркозола, содержащего 1 мМ фенилметилсульфонилфторид (PMSF, Sigma-Aldrich, Сент-Луис, США) в качестве ингибитора протеазы.Фракции анализировали вестерн-блоттингом, как описано ранее. Для иммунного обнаружения слитых белков мембраны зондировали кроличьим антихолерным токсином (1-2000, Abcam, Великобритания), кроличьими антителами против pgsA (1-1000) и кроличьими анти-M2 (1-1000) антителами. Кроличьи антитела против pgsA и кроличьи антитела против M2, использованные в этом эксперименте, были получены с помощью i.m. инокуляция KLH-конъюгированного пептида pgsA или M2 кролику, соответственно, два раза с интервалом в 2 недели. Мембраны реагировали с разведением 1-10 000 антикроличьего иммуноглобулина G, конъюгированного с пероксидазой хрена (IgG HRP).Наконец, целевые белки были обнаружены с использованием системы WEST-ZOL plus Western Blot Detection System (iNtRON Biotechnology, Gyeonggi-do, Корея) и визуализированы с помощью усиленной хемилюминесценции (ECL) [17], [26], [28].

Проточная цитометрия и иммунофлуоресцентная микроскопия

Для исследования экспрессии sM2 или CTA1-sM2 на поверхности L. casei рекомбинантный L. casei выращивали при 30 ° C в течение 48 часов в бульоне MRS. Бактерии собирали центрифугированием при 5000 × g в течение 10 минут при 4 ° C, трижды промывали стерильным фосфатно-солевым буфером, содержащим 0.01% Tween-20 (PBST) и зондировали поликлональными кроличьими анти-M2 или кроличьими анти-CT антителами в течение ночи. После другой промывки клетки обрабатывали конъюгированными с флуоресцеина изотиоцианатом (FITC) антителами против IgG кролика (Burlingame, CA, USA) в течение 2 часов. Наконец, 10000 клеток анализировали проточной цитометрией (Becton Dickinson, Oxnard, CA, USA). Для иммунофлуоресценции клетки получали в тех же условиях, которые описаны для проточной цитометрии. PgsA / L. casei использовали в качестве отрицательного контроля, и анализ иммунофлуоресценции исследовали с использованием флуоресцентного микроскопа Carl Zeiss Axioskop 2.

ELISA

Титры антител измеряли с помощью иммуноферментного анализа (ELISA) с использованием образцов сыворотки или слизистой оболочки вакцинированных мышей. Сначала 96-луночные планшеты с иммуносорбентом (Nunc) инкубировали с 300 нг / лунку очищенных белков sM2 или CTA1 при 4 ° C в течение ночи. Рекомбинантные белки sM2 и CTA1, использованные в этом исследовании, были очищены от E. coli . Затем лунки блокировали 10% обезжиренным молоком в течение 2 часов при комнатной температуре, пять раз промывали PBST, обрабатывали разбавленными образцами сыворотки (1∶200) в трех экземплярах для обнаружения IgG и неразбавленным гомогенизированным тканевым супернатантом для обнаружения местного IgA и инкубировали в течение 2 часа при 37 ° C.После трехкратной промывки в каждую лунку добавляли козий антимышиный IgG HRP (1-1000, сигма) или антимышиный IgA и инкубировали еще 2 часа при 37 ° C. После еще одного цикла промывки планшеты реагировали с раствором субстрата, содержащим тетраметилбензидин и H 2 O 2 , и давали возможность предшествовать реакции в течение 10 минут. После добавления стоп-раствора 2N-H 2 SO 4 , оптическую плотность (OD) измеряли при 450, нм, , используя автоматический считыватель ELISA (Molecular devices).

ELISPOT Assay

Выработку и подсчет цитокинов проводили с помощью ELISPOT, как описано ранее [31], [32]. Вкратце, за день до выделения спленоцитов 96-луночные планшеты для ELISPOT покрывали моноклональными антителами против IFN-γ и IL-4 мыши (5 мкг / мл) в PBS и инкубировали при 4 ° C в течение ночи. Планшеты промывали PBS, добавляли 200 мкл / лунку блокирующего раствора, содержащего полную среду RPMI 1640 и 10% фетальную бычью сыворотку (Invitrogen, Carlsbad, CA, USA), и инкубировали в течение 2 часов при комнатной температуре.Селезенки вакцинированных мышей выделяли в асептических условиях и добавляли в количестве 5 × 10 4 клеток / лунку в среду, содержащую белок sM2, пептид M2 (SLLTEVETPTRNGWECKCSD) (1 мкг / лунку), только среду (отрицательный контроль) или 5 мкг / мл. фитогемагглютинин (положительный контроль, Invitrogen, Carlsbad, CA, USA). После добавления клеток и стимуляторов планшеты инкубировали в течение 24 часов при 37 ° C с 5% CO 2 . Планшеты последовательно обрабатывали биотинилированными антителами против IFN-γ и IL-4 мыши, стрептавидин-пероксидазой хрена и раствором субстрата.Наконец, пятна подсчитывали с помощью анализатора ImmunoScan Entry (Cellular Technology, Shaker Heights, США).

Титр вируса легких

Легкие собирали в асептических условиях, и титры вируса определяли с помощью 50% дозы инфицирования тканевой культуры (TCID 50 ), как описано ранее [33]. Вкратце, ткани легких гомогенизировали в 500 мкл PBS, содержащего антибиотики (пенициллин и стрептомицин) и соединения антимикотиков (фунгизон) (Gibco, Grand Island, NY, США). Механически гомогенизированные образцы легких центрифугировали (15 минут, 12000 × g и 4 ° C) для удаления клеточного дебриса перед их хранением при -80 ° C.Клетки MDCK инокулировали 10-кратным серийно разведенным образцом и инкубировали при 37 ° C во влажной атмосфере с 5% CO 2 в течение часа. После абсорбции среду удаляли, и верхнюю среду, содержащую трипсин L-1-тозиламидо-2-фенилэтилхлорметилкетон (TPCK) (Thermo Fisher Scientific, Rockford, USA), добавляли к инфицированным клеткам и инкубировали в течение 72 часов. Цитопатические эффекты вирусов наблюдались ежедневно, и титры определялись с помощью теста HA. Вирусный титр каждого образца был выражен как дозы, инфицированные 50% ткани, с использованием метода Рида-Мюнча [34].

Гистопатология и иммуногистохимия

Для гистопатологии легочные ткани собирали с разрешением 5 dpi у мышей под наркозом эфиром. Ткани немедленно фиксировали в 10% формалине, содержащем нейтральный буфер, заливали парафином, делали срезы толщиной 4–6 мкм с помощью микротома, устанавливали на предметные стекла и окрашивали эозином. Патогистологические изменения исследовали с помощью световой микроскопии, как описано ранее [29], [30], [35]. Кроме того, предметные стекла окрашивали иммунопероксидазным методом с использованием антител (кроличьи анти-M2, 1-500), направленных против матричного белка-2 вируса гриппа А.Козьи антикроличьи IgG HRP (1-2000, Sigma-Aldrich, Сент-Луис, США) использовали в качестве вторичных антител для обнаружения инфицированных вирусом клеток в соответствующих тканях [57].

Статистика

Данные представлены как среднее значение ± стандартное отклонение (стандартное отклонение) и являются репрезентативными по крайней мере для трех независимых экспериментов. Различия между группами анализировали с помощью дисперсионного анализа (ANOVA), а средние значения сравнивали с помощью теста Стьюдента t . P -значения меньше 0.05 были расценены как значимые. Результаты для процента начальной массы тела также сравнивались с использованием теста Стьюдента t . Сравнение выживаемости проводилось с помощью лог-рангового теста с использованием версии GraphPad Prism 6.

Результаты

Конструирование плазмид, содержащих sM2 с или без CTA1 и экспрессии на

L. casei

Вектор, экспрессирующий pgsA, использовали для конструирования плазмид, содержащих высококонсервативный консенсусный ген sM2, с (pgsA-CTA1-sM2) или без (pgsA-sM2) субъединицей A1 холерного токсина (CTA1,).Плазмидами трансформировали клеток L. casei . Уровни экспрессии pgsA-sM2 и pgsA-CTA1-sM2 контролировали с помощью иммуноблоттинга с использованием поликлональных антител против pgsA, анти-M2 или анти-CT (данные не показаны).

Конструирование и поверхностная экспрессия sM2 и CTA1-конъюгированного белка sM2 на Lactobacillus casei .

(A) Схематическая диаграмма плазмид pgsA-sM2 и pgsA-CTA1-sM2. (B) Вестерн-блоттинг рекомбинантных pgsA-sM2 / L. casei и pgsA-CTA1-sM2 / L.casei с использованием поликлональных антител против pgsA (вверху), против M2 (в центре) и против CT (внизу). Дорожки 1 и 2 показывают L. casei и L. casei с родительским вектором (pgsA / L. casei ) соответственно. Дорожки 3 и 4 показывают pgsA-sM2 и pgsA-CTA1-sM2 соответственно. Полосы белка 42, 52 и 74 кДа, соответствующие pgsA, pgsA-sM2 и pgsA-CTA1-sM2, соответственно, были обнаружены на дорожках 2, 3 и 4 целых клеточных лизатов (слева) и во фракциях внешней мембраны (средняя ), но не в цитоплазме (справа).(C) Анализ клеточной сортировки с активацией флуоресценции (FACS) клеток L. casei (закрашенные) и рекомбинантных клеток L. casei (открытые). Клетки реагировали либо с кроличьими анти-sM2 (слева), либо с анти-CT (справа) поликлональными антителами, после чего следовала реакция с флуоресцентным изотиоцианат-конъюгированным (FITC) антителом против кроличьего IgG. (D) Репрезентативные изображения иммунофлуоресценции клеток L. casei (контроль) и рекомбинантных клеток L. casei , экспрессирующих sM2 и CTA1-sM2. Клетки обрабатывали анти-M2 или анти-CT, а затем FITC-конъюгированными антителами против IgG кролика.Справа показаны изображения в ярком поле. (E) Протоколы экспериментов по вакцинации мышей и заражению вирусом. Мышей группировали, как указано в материалах и методах, и вводили перорально или назально в соответствии с графиком. Стрелками указаны пути и периоды иммунизации клеток pgsA / L. casei , pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L. casei . Сыворотки собирали на 0, 14 и 28 дни; образцы из легких и кишечника собирали на 28 день после иммунизации.Через неделю после последней иммунизации у 3 мышей в каждой группе вырезали селезенки, используя один набор для анализа CTL. Через две или 24 недели после последней иммунизации всех мышей заражали смертельной дозой подтипов гриппа интраназальным путем и наблюдали в течение 13 дней. На 3 и 5 дни после инфицирования у 3 мышей в каждой группе вырезали легкие для определения титра вируса. На 5 dpi мышей из одной группы умерщвляли для гистопатологии легких и иммуногистохимии.

Для определения клеточной локализации белков sM2 и CTA1, экспрессируемых на поверхности L.casei через якорь клеточной стенки pgsA, мембранные и цитоплазматические фракции подвергали вестерн-блоттингу. Как и ожидалось, слитые белки pgsA-sM2 и pgsA-CTA1-sM2 детектировались поликлональными антителами против pgsA, анти-M2 или анти-CT в мембране, а не в цитоплазматических фракциях (полосы 2, 3 и 4). Иммунореакции проводили с анти-pgsA, и полосы, представляющие размер слитых белков pgsA-sM2 и pgsA-CTA1-sM2, были обнаружены, в то время как во время реакций с анти-M2 или анти-CT антителами других полос обнаружено не было (, дорожки 3 и 4).Это открытие могло быть результатом разложения, которое происходит во время процедуры мембранного фракционирования.

Сортировка клеток с активацией флуоресценции (FACS) и иммунофлуоресцентное мечение клеток были использованы для проверки локализации слитого белка pgsA-sM2 и pgsA-CTA1-sM2 на поверхности L. casei . Проточный цитометрический анализ с использованием кроличьих анти-M2 и анти-CT антител выявил повышение уровня интенсивности флуоресценции pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L.casei по сравнению с контрольными клеток L. casei (). Иммунофлуоресцентная микроскопия также показала рекомбинантные бактерии, несущие pgsA-sM2 или pgsA-CTA1-sM2, которые иммуноокрашены положительно на sM2 и CTA1, но этого не было обнаружено в контрольных клетках. Эти результаты продемонстрировали, что рекомбинантный L. casei может эффективно отображать слитые белки sM2 и CTA1-sM2 на поверхности, используя pgsA в качестве якорного белка мембраны.

Иммунные ответы, вызванные иммунизацией слизистой оболочки

L.casei Отображаемая поверхность sM2 и CTA1-sM2

Был проведен предварительный эксперимент для определения доз и графика вакцины-кандидата pgsA-CTA1-sM2 / L. casei для защиты от вируса гриппа (данные не показаны). Чтобы охарактеризовать иммуногенность поверхностно-отображаемого sM2 L. casei и sM2, конъюгированного с CTA1, мышей BALB / c иммунизировали назально (10 9 клеток / доза 20 мкл) или перорально (10 10 клеток / 100 мкл). доза) с рекомбинантным живым pgsA-sM2 / L.casei и бактерии pgsA-CTA1-sM2 / L. casei . В качестве отрицательного контроля мышей иммунизировали L. casei , несущим родительскую плазмиду pKV-pgsA (pgsA / L. casei ) и PBS. Образцы сыворотки собирали через 0, 14 и 28 дней и анализировали с помощью ELISA, используя белки sM2 и CTA1 (очищенные из E. coli ) в качестве покрывающего антигена. После первой серии иммунизации сравнительно низкие уровни сывороточного IgG были обнаружены как в i.n. и перорально иммунизированная группа.Однако высокие уровни антител были обнаружены вскоре после второй серии иммунизации, и группа sM2, конъюгированная с CTA1, индуцировала сывороточный IgG на значительном уровне по сравнению с группой только sM2 и отрицательными контролями (). Хотя ожидалось, что конъюгация CTA1 с sM2 будет иметь только адъювантную функцию, значительный уровень антител против CTA1 был обнаружен как при назальной, так и при пероральной вакцинации (). По сравнению с пероральной группой, группа, иммунизированная через нос, показала более высокие уровни сывороточного IgG, специфичного как к sM2, так и к CTA1.

Оценка иммунных ответов после введения рекомбинантного L. casei мышам Balb / c.

Мышей иммунизировали перорально или интраназально с помощью PBS, pgsA / L. casei , pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L. casei от 0 до 3, от 7 до 9 и 21. до 23 дней перорально или от 0 до 3, от 7 до 9 и 21 дней интраназально. Сыворотку собирали на 0, 14 и 28 дни. Легкие и кишечник мышей собирали на 28 день. (A и B) Поглощение антител IgG, специфичных к белкам sM2 (слева) и CTA1 (справа) в интраназальных ( вверху) и устные (внизу) группы.(C и D) Поглощение антитела IgA, специфичного к белку sM2, в легких (слева) и кишечнике (справа) в интраназальной (вверху) и пероральной (внизу) группах. Сывороточный IgG, легочный IgA и кишечный IgA исследовали с помощью ELISA и измеряли при поглощении 450 нм . Столбцы обозначают среднее ± стандартное отклонение. Звездочка указывает на значительную разницу между pgsA-CTA1-sM2 / L. casei и другими группами (* P <0,05).

Для оценки иммунных ответов слизистых оболочек локальные уровни IgA определяли с помощью ELISA.Ткани легких и кишечника собирали на 28 день иммунизации и исследовали с использованием белка sM2 в качестве покрывающего антигена. При обоих путях вакцинации pgsA-CTA1-sM2 / L. casei индуцировал значительно повышенные уровни sM2-специфического IgA слизистой оболочки по сравнению с pgsA-sM2 / L. casei и контрольными группами. Однако, как и ожидалось, на месте инокуляции были обнаружены более высокие уровни титров антител, чем на удаленных участках. Сходный образец ответа антител наблюдался для обоих путей иммунизации, в которых pgsA-CTA1-sM2 / L.casei группы преобладали (). Эти данные продемонстрировали, что sM2, конъюгированный с субъединицей токсина холеры A1, приводил к значительному увеличению уровней sM2-специфического IgG и слизистых оболочек IgA по сравнению с одним sM2 или с контролями, иммунизированными pgsA / L. casei или PBS.

Иммунизация слизистой оболочки

L. casei Поверхностный sM2 и CTA1-sM2, стимулированный M2-специфический клеточный иммунный ответ

Чтобы определить, может ли вакцинация слизистой оболочки L. casei поверхностно отображаемым sM2 и sM2, конъюгированным с CTA1, индуцировать клеточную иммунитета, IFN-γ и IL-4 ELISPOT.Спленоциты вакцинированных мышей стимулировали 10 мкг / мл рекомбинантного белка sM2 или пептида M2, и были разработаны ELISPOT цитокинов. Пятна подсчитывали для измерения различий в ответах CTL между группами. Клетки мышей, иммунизированных i.n. с pgsA-CTA1-sM2 / L. casei показал значительные уровни IFN-γ в ответ на стимуляцию белком sM2 и пептидом M2 (). Точно так же мы заметили, что i.n. группы, которым вводили как pgsA-sM2 / L. casei , так и pgsA-CTA1-sM2 / L.casei показал определяемые уровни спленоцитов, секретирующих IL-4, после стимуляции либо белком sM2, либо пептидом M2 (). Клетки, секретирующие IFN-γ и IL-4, также наблюдались у мышей, иммунизированных перорально pgsA-sM2 / L. casei и pgsA-CTA1-sM2 / L. casei (), хотя их уровни были ниже, чем i.n. группы и не были значимыми. Контрольная группа, иммунизированная pgsA / L. casei , показала уровень фоновых пятен как для интраназальных, так и для пероральных групп. Эти данные показывают, что высококонсервативный sM2 может индуцировать M2-специфические IFN-γ и IL-4 секретирующие Т-клеточные ответы, в то время как доставка через слизистую через L.casei и конъюгация CTA1 с sM2 усиливали клеточно-опосредованный иммунитет, что может способствовать расширению защитного иммунитета.

Определение цитокин-продуцирующих спленоцитов.

Цитокинов (IFN-γ и IL-4) подсчитывали с помощью ELISPOT через 7 дней после последней иммунизации спленоцитами. (A и C) Количество пятен, специфичных для IFN-γ на 5 × 10 5 спленоцитов стимулировали белками sM2 (слева) и пептидами M2 (справа) интраназально (вверху) и перорально (внизу) иммунизированных групп.(B и D) Количество пятен, специфичных к IL-4, на 5 × 10 5 спленоцитов, стимулированных белком sM2 (слева) и пептидом M2 (справа) интраназально (вверху) и перорально (внизу) иммунизированных групп. NC обозначает отрицательные контроли (неиммунизированные), а PC обозначает положительные контроли клеток, стимулированных митогеном. Столбцы обозначают среднее ± стандартное отклонение. Звездочка указывает на значительную разницу между pgsA-CTA1-sM2 / L. casei и другими группами (* P <0,05).

Защита от проблем с различными подтипами вируса гриппа, содержащими гетерологичную последовательность sM2

M2 известен как потенциальная цель для разработки вакцины против гриппа широкого спектра действия с минимальной вариабельностью [36], [37].Чтобы подтвердить вариабельность последовательностей sM2 зараженных вирусов, используемых в этом исследовании, мы сравнили sM2 подтипов гриппа, доступные в Национальном центре биотехнологической информации США (NCBI), с нашей консенсусной последовательностью sM2, в частности всей консервативной экто и некоторой частью цитоплазматического домена. (CD), хотя вся CD была включена в конструкцию вакцины (). Мы обнаружили, что вирусы, использованные в этом исследовании, содержат 0-8 несовпадающих аминокислот среди аминокислот sM2, сравниваемых в этом исследовании.Для оценки эффективности вакцины sM2 через неделю после последней иммунизации мышей заражали внутривенно. с 10 MLD 50 подтипов вируса гриппа A / Aquatic bird / Korea / W81 / 2005 (H5N2), которые были гомологичны консенсусной последовательности sM2. Мыши, иммунизированные перорально pgsA-sM2 / L. casei и pgsA-CTA1-sM2 / L. casei , показали 40 и 60% защиты соответственно. Аналогично, i.n. группы иммунизации дали 40 и 80% против смертельной инфекции высоковирулентным вирусом H5N2.Напротив, ни одна из неиммунизированных мышей не выжила после летального заражения (). Заболеваемость увеличивалась у мышей, иммунизированных пероральным путем, тогда как мыши, которым вводили внутривенно. иммунизация pgsA-CTA1-sM2 / L. casei потеряла <20% своей исходной массы тела и начала восстанавливаться к 9 дню после инфицирования (dpi) и полностью выздоровела к 13 дню ().

Эффективность защиты рекомбинантных LAB против инфекций с дивергентными подтипами вируса гриппа.

Пятинедельных самок мышей BALB / c (по 5 на группу) вакцинировали PBS, pgsA / L.casei , pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L. casei в возрасте от 0 до 3, от 7 до 9 и 21 дней, в т.ч. или от 0 до 3, от 7 до 9 и от 21 до 23 дней перорально. Вакцинированные мыши были инфицированы внутримышечно. с 10 LD 50 адаптированных к мыши подтипов дивергентного гриппа. (A-J левая панель) показаны процентное изменение исходной массы тела и (A-J правая панель) выживаемость после заражения. (A-J левая панель) Планки погрешностей отображают стандартную ошибку среднего. *, Группы различаются по потере веса, P <0,05 (тест Стьюдента t ).В отношении выживаемости мыши, вакцинированные (особенно в группе) pgsA-CTA1-sM2 / , L. casei были значительно лучше защищены, чем PBS, pgsA / L. casei , pgsA-sM2 / L. casei после летального заражения. с (A и B, правая панель) A / Aquatic bird / Korea / W81 / 2005 (H5N2) (лог-ранговый тест, P = 0,00063 и P = 0,045 соответственно), (C и D, правая панель) A / Puerto Rico / 8/34 (h2N1) (логранговый тест, P = 0,01 и P = 0,02 соответственно), (E и F, правая панель) A / Chicken / Korea / 116/2004 (H9N2 ) (логранговый тест, P = 0.0004 и P = 0,004 соответственно), (G и H, правая панель) A / EM / Korea / W149 / 06 (H5N1) (логранговый тест, P = 0,001 и P = 0,06 соответственно) и (I и J, правая панель) A / Aquatic bird / Korea / W44 / 2005 (H7N3) (лог-ранговый тест, P = 0,02 и P = 0,56 соответственно).

Таблица 1

Сравнение последовательности sM2 между вакцинным и контрольным штаммами.

+ + 90 att151 ent { "JN244137.1 "," term_id ":" 341610113 "}} JN244137.1
Штамм вируса Подтип Аминокислотная последовательность Номер доступа
Консенсус MSLLTEVETPTRNGWECKCSDSSDPDRLFFKCIYRRLKYGLKRGPSTEGV
А / EM / Корея / W149 / 06 H5N1 MSLLTEVETPTRN Е WECRCSDSS Д PDRLFFKCIYRRLKYGLKRGPSTEGV { "Тип": "Entrez -protein "," attrs ": {" text ":" ABW73743.1 "," term_id ":" 158538702 "}} ABW73743.1
A / Aquaticbird / Korea / W81 / 2005 H5N2 MSLLTEVETPTRNGSSW D PDRLFFKCIYRRLKYGLKRGPSTEGV {"тип": "энтрез-нуклеотид", "attrs": {"текст": "EU819138.1 "," term_id ":" 193074905 "}} EU819138.1
A / Пуэрто-Рико / 8/34 h2N1 MSLLTEVETPIRN E W G C R C C 9069 D PDRLFFKCIYRR F KYGLK G GPSTEGV {"type": "entrez-нуклеотид", "attrs": {"text": "NC_002016.1", "term_id": "8486122"}} NC_002016. 1
A / Aquaticbird / Korea / W44 / 2005 H7N3 MSLLTEVETPTRNGWEC R CSDSS D PDRLFFKCIYRRLKYGLKRGPSTEGV
A / Курица / Корея / 116/2004 H9N2 MSLLTEVETPTRNGWECKCSDSS D P FF L RLGRL69 {"type": "entrez-нуклеотид", "attrs": {"text": "EU819104.1", "term_id": "193074803"}} EU819104.1

Далее мы оценили защиту эффективность вакцины-кандидата sM2 против A / Puerto Rico / 8/34 (h2N1), которая содержит 8 несовпадающих аминокислот относительно консенсусной последовательности sM2.Наборы вакцинированных мышей заражали 10 MLD 50 вируса h2N1. Как показано на фиг.1, мыши, иммунизированные in-путём, показали более высокий уровень защиты, чем группы, иммунизированные перорально, а мыши, иммунизированные pgsA-CTA1-sM2 / L. casei , показали значительно более высокий уровень защиты по сравнению с мышами, иммунизированными pgsA. -sM2 / L. casei (). Неиммунизированные мыши потеряли до 40% массы тела и умерли на 9 dpi. Мышей, иммунизированных pgsA-CTA1-sM2 / L.casei потеряла примерно 10% своей массы тела, тогда как мыши, иммунизированные pgsA-sM2 / L. casei , потеряли> 20% своей исходной массы тела на 9 dpi и выздоравливали медленнее, чем мыши, иммунизированные pgsA-CTA1-sM2 / L. casei ().

Другая группа вакцинированных мышей была инфицирована A / Chicken / Korea / 116/2004 (H9N2) для проверки диапазона защитной способности иммунных ответов, индуцированных вакциной sM2. Последовательность sM2 H9N2 содержит 2 несовпадающих относительно консенсусной последовательности sM2.Мыши, иммунизированные pgsA-CTA1-sM2 / L. casei , показали незначительную потерю массы тела и постепенное восстановление по сравнению с мышами, иммунизированными pgsA-sM2 / L. casei и неиммунизированными мышами как для внутривенного, так и для перорального пути. (). Ни одна из неиммунизированных мышей выжила, тогда как 100% и 80% мышей иммунизировали pgsA-CTA1-sM2 / L. casei через i.n. и оральные пути сохранились, соответственно. Показатели выживаемости мышей, иммунизированных pgsA-sM2 / L. casei , составляли 80% и 60% для i.п. и пероральный пути, соответственно ().

Также оценивалась широта защиты вакцины sM2 от различных подтипов гриппа. Набор иммунизированных мышей заражали высокопатогенным птичьим гриппом (HPAI) A / EM / Korea / W149 / 06 (H5N1), который содержит 2 несоответствия аминокислот относительно консенсусной последовательности sM2. Мышей, иммунизированных через i.n. и пероральные пути с pgsA-CTA1-sM2 / L. casei показали более высокую эффективность защиты, 80% и 60%, соответственно, по сравнению с мышами, иммунизированными pgsA-sM2 / L.casei , для которых ставки составили 60% и 20% соответственно (). Что касается заболеваемости, мыши, иммунизированные pgsA-CTA1-sM2 / L. casei , показали более низкую заболеваемость, чем мыши, иммунизированные pgsA-sM2 / L. casei (). Еще одну группу вакцинированных мышей заражали вирусом A / Aquatic bird / Korea / W44 / 2005 (H7N3), который содержит 1 несоответствие относительно согласованной последовательности sM2, а вес тела и выживаемость наблюдали для 13 dpi. Как показано на фиг.2, неиммунизированные мыши потеряли до 30% массы тела, чем мыши, иммунизированные pgsA-sM2 / L.casei и pgsA-CTA1-sM2 / L. casei (). Мыши, иммунизированные pgsA-CTA1-sM2 / L. casei внутримышечно, показали значительно более высокий уровень защиты от вируса гриппа H7N3, чем другие группы (). Взятые вместе, результаты показывают, что i.n. иммунизация pgsA-CTA1-sM2 / L. casei индуцировала иммунные ответы, которые обеспечивали значительный уровень защиты от дивергентных подтипов вирусов гриппа, содержащих несовпадающие аминокислоты в диапазоне от 0 до 8 согласованного sM2, независимо от того, был ли он полным или частичным .

Титры вирусов в легких и гистопатология

Титры вирусов в легких зараженных мышей измеряли для оценки репликации при 3 и 5 dpi. Мышей иммунизировали внутримышечно и перорально pgsA-sM2 / L. casei и pgsA-CTA1-sM2 / L. casei и заражали подтипами гриппа H5N2, h2N1, H9N2, H5N1 или H7N3. При 3 и 5 dpi по 3 мыши из каждой группы случайным образом умерщвляли, и их титры вируса легких измеряли с использованием метода TCID 50 .Мыши, иммунизированные pgsA-CTA1-sM2 / L. casei , имели более низкие титры при 3 dpi и имели значительно сниженную репликацию вируса при 5 dpi по сравнению с мышами, иммунизированными pgsA-sM2 / L. casei или контрольными группами в то же время. время (). Снижение вирусных титров в легких наблюдалось в группах мышей, иммунизированных внутривенно, по сравнению с мышами, иммунизированными пероральным путем, особенно на 3-й день после инфицирования (). Эти пониженные титры могут быть связаны с одинаковыми путями вакцинации и заражения, а титры коррелируют с результатами выживания при летальных инфекциях, вызванных H5N2, h2N1, H9N2, H5N1 и H7N3.Взятые вместе, эти результаты демонстрируют, что консенсусный белок sM2, слитый с CTA1, обеспечивает лучшую защиту, чем sM2, а путь i.n более эффективен, чем пероральный путь иммунизации, в отношении защиты от летального заражения различных подтипов гриппа.

Титры вируса легких, гистопатология и иммуногистохимия.

Титры вируса в тканях легких определяли с помощью TCID 50 в клеточной линии MDCK через 3 и 5 точек на дюйм после заражения (A и B) A / Aquatic Bird Korea / W81 / 2005 (H5N2), (C и D ) A / Puerto Rico / 8/34 (h2N1), (E и F) A / Chicken / Korea / 116/2004 (H9N2), (G и H) A / EM / Korea / W149 / 06 (H5N1) и ( I и J) Подтипы гриппа A / Aquatic Bird / Korea / W44 / 2005 (H7N3).(K) Легкие мышей, вакцинированных pgsA-CTA1-sM2 / L. casei , показали прозрачные альвеолы ​​без инфильтрации воспалительных клеток, в отличие от легких мышей, вакцинированных pgsA-sM2 / L. casei или контрольных мышей. , оба из которых выявили признаки тяжелого пневмонита (средняя и левая панели). Уменьшение количества вирусных антигенов было обнаружено в легких мышей, вакцинированных pgsA-CTA1-sM2 / L. casei , в отличие от легких мышей, вакцинированных pgsA-sM2 / L.casei или контроль выявили признаки тяжелого пневмонита с повышением антигена вируса (правая панель). Микрофотографии репрезентативны для каждой группы лечения при увеличении 200X. Антиген вируса в эпителиальных клетках проявляется в коричневой окраске ядра и цитоплазмы. В титрах легких столбцы обозначают среднее ± стандартное отклонение. Звездочка указывает на значительную разницу между pgsA-CTA1-sM2 / L. casei и другими группами (* P <0,05).

Гистопатология и иммуногистохимия были выполнены для подтверждения результатов титра вируса легких.При разрешении 5 dpi из каждой группы из одного набора случайным образом отбирали легкие, фиксировали и окрашивали эозином перед исследованием под световым микроскопом. Как показано на фиг.4, явные признаки глубокого легочного воспаления наблюдались в легких мышей, получавших PBS или pgsA / L. casei как для перорального, так и для перорального пути введения, тогда как в легких мышей, иммунизированных pgsA-CTA1- sM2 / L. casei не показал заметного легочного воспаления по сравнению с pgsA-sM2 / L.casei -обработанные мыши (средняя и левая панели). В иммуногистохимии использовали иммунопероксидазный метод с антителом, направленным против матричного протеина-2 вируса гриппа A, для обнаружения инфицированных вирусом клеток в соответствующих тканях. Антиген вируса в эпителиальных клетках проявляется в коричневой окраске ядра и цитоплазмы. Как показано на фиг.4, через 5 дней после вакцинации большое количество инфицированных вирусом клеток было обнаружено у контрольных мышей или мышей, вакцинированных pgsA-sM2 / L. casei , тогда как сильно уменьшенное количество антиген-положительных клеток было обнаружено у мышей, вакцинированных pgsA-CTA1- sM2 / Л.casei , оба в i.n. и перорально иммунизированная группа (). Эти результаты показывают, что у мышей, иммунизированных pgsA-CTA1-sM2 / L. casei , развились иммунные ответы, достаточно сильные для подавления репликации вируса, что способствует выживанию мышей после летального заражения гриппом A.

PgsA-CTA1 -sM2 /

L. casei Длительная перекрестная защита, индуцированная вакцинацией

Продолжительность защиты - важный критерий для потенциальной вакцины. Таким образом, продолжительность иммунитета, индуцированного sM2, и sM2, конъюгированного с CTA1, исследовали путем определения сывороточного IgG и IgA слизистой оболочки с помощью ELISA.Через 180 дней после вакцинации наблюдалось значительное повышение уровней sM2-специфического сывороточного IgG, а также легочного и кишечного IgA () по сравнению с группами PBS и pgsA / L. casei . Мышей заражали A / Aquatic bird / Korea / W81 / 2005 (H5N2), и отслеживали изменения массы тела и выживаемость до 13 dpi. Неиммунизированные мыши показали потерю массы тела> 30% () и умерли на 9 день после инфицирования как при пероральном, так и внутримышечном введении. группы. Напротив, мыши, иммунизированные pgsA-CTA1-sM2 / L.casei показал незначительную потерю массы тела, которая была восстановлена ​​на 13 dpi; 80% выжили в i.n. иммунизированная группа (), и 60% выжили в группе, иммунизированной перорально (). Этот результат показывает, что вакцина слизистой оболочки sM2, конъюгированная с CTA1, обеспечивала защиту от летальной инфекции через 6 месяцев после последней иммунизации.

Долговременная защита от различных подтипов гриппа.

Группы мышей иммунизировали согласно графику, либо внутримышечно. или перорально, с PBS, pgsA / L.casei , pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L. casei . Сыворотки собирали на 0, 28 и 180 дни после последней вакцинации. Образцы легких и кишечника собирали на 180 день. ELISA выполняли в трех повторностях с использованием покрытого белка sM2 для подтверждения долгосрочных уровней антител как IgG, так и IgA. Мышей заражали летальными дозами вируса A / Aquatic bird / Korea / W81 / 2005 (H5N2) (10 MLD 50 ) через 6 месяцев после последней вакцинации. (A и C слева), абсорбция сывороточного IgG, (A и C справа) легкие и кишечные IgA, специфичные к белку sM2 интраназальной (вверху) и пероральной (внизу) групп.Столбцы обозначают средние значения ± S.D. Звездочка указывает на значительную разницу между pgsA-sM2 / L. casei или pgsA-CTA1-sM2 / L. casei и PBS или pgsA / L. casei (* P <0,05). (B и D левая панель) показаны процент от начальной массы тела и (B и D правая панель) выживаемость после заражения. (B и D левая панель) Планки погрешностей отображают стандартную ошибку среднего. *, Группы различаются по потере веса, P <0,05 (тест Стьюдента t ).В отношении выживаемости (B и D правая панель) как интраназальная, так и пероральная вакцинация pgsA-CTA1-sM2 / L. casei была значительно лучше защищена, чем PBS, pgsA / L. casei , pgsA-sM2 / L. casei после летального заражения A / Aquatic bird / Korea / W81 / 2005 (H5N2) (лог-ранговый тест, P = 0,01 и P = 0,006 соответственно).

Обсуждение

Иммунная система слизистой оболочки является первым иммунологическим барьером против патогенов, которые проникают в организм через поверхность слизистой оболочки.Таким образом, индукция иммунитета слизистых оболочек необходима для обеспечения защиты от нескольких подтипов вируса гриппа А. Респираторный вирус гриппа А является причиной ежегодных сезонных эпидемий во всем мире, а иногда и пандемий, которые вызываются новыми подтипами / штаммами, полученными путем пересортировки с вирусами птиц или свиней. Современные противогриппозные вакцины обеспечивают только штаммоспецифичную защиту. Таким образом, крайне важно создать вакцину против гриппа с широкой перекрестной защитой. Антигены, которые хорошо законсервированы среди вирусов гриппа А, считаются многообещающими мишенями для индукции перекрестной защиты против этих различных подтипов.Однако целью должно быть развитие первой линии защиты путем эффективного устранения патогенов на поверхности слизистой оболочки. Протеин-2 матрикса гриппа (M2) относительно хорошо консервативен среди подтипов гриппа и может считаться многообещающим антигеном вакцины против гриппа [30]. Он состоит из следующих трех структурных доменов: внеклеточного домена из 24 аминокислот, трансмембранного домена из 19 аминокислот и хвостового цитоплазматического домена из 54 аминокислот [39], [40]. В этом исследовании использовались внеклеточные и цитоплазматические домены, которые хорошо законсервированы среди вирусов гриппа и играют важную роль в сборке и морфогенезе вирусов.Здесь мы разработали консенсус sM2, полученный на основе анализа последовательностей подтипов H5N1, h2N1 и H9N2 в базе данных. Принимая во внимание предыдущие открытия, в частности, внеклеточный домен (aa, 1-13) является высококонсервативным среди подтипов вируса гриппа и распознается как эпитоп для индукции моноклональных антител, которые могут защищать инфекцию вируса гриппа [56], последовательность основной цепи sM2 от H5N1 вирус. Для возможной гомологии среди других подтипов мы изменили положение 14 (E – G) и 18 (R – K) и оставили неизменным консервативный эпитоп (aa, 1–13).Как показано при выравнивании последовательностей, sM2 консенсусной последовательности имеет 0-8 несовпадений среди подтипов, используемых в этом исследовании ().

Более того, включение адъюванта считается важным для усиления взаимодействия вакцины с иммунной системой слизистой оболочки [41]. Были изучены различные адъюванты, такие как липосомы, наночастицы и иммуностимулирующие комплексы (ISCOM), и было обнаружено, что они улучшают иммунный ответ [42], но их эффективность не была оптимальной. Несмотря на его потенциал в качестве адъюванта для слизистых оболочек [43], использование холерного токсина (ХТ) в вакцинах ограничено его врожденной токсичностью.Таким образом, токсичность СТ необходимо отделить от его адъювантности, прежде чем его можно будет использовать в качестве адъюванта вакцины. Исследования показали, что конструкции, состоящие из M2e, слитого с субъединицей A1 холерного токсина вместе с сильным ADP-рибозилирующим агентом и димером D-фрагмента вакцины Aureus Staphylococcus aureus , обеспечивали полную защиту и снижали заболеваемость [6], [44]. ]. CTA1 сохраняет адъювантную функцию CT без его токсических побочных эффектов, таких как реактогенность в месте его введения и связывание или накопление в нервных тканях [45].На основании предыдущих результатов было выдвинуто предположение, что консенсусный фрагмент sM2 при слиянии с мощным адъювантом слизистой оболочки CTA1 может индуцировать широкий защитный иммунитет против дивергентных подтипов вируса гриппа. В этом исследовании мы использовали весь белок CTA1 массой 22 кДа (ADP-рибозилтрансфераза), который состоит из трех отдельных субдоменов: CTA11 (остатки от 1 до 132), CTA12 (остатки от 133 до 161) и CTA13 (остатки от 162 до 192). . Сообщалось, что CTA1, лишенный CTB, обладает сильной адъювантной активностью без какой-либо токсичности.CTA1 усиливает ответы антител IgA и IgG, а также активность CTL [47].

Для разработки универсальной противогриппозной вакцины для слизистых оболочек с консервативным пептидом sM2 и мощным адъювантом CTA1 был сконструирован рекомбинантный L. casei , отображающий sM2, слитый с CTA1 или без него, для доставки через слизистые оболочки с помощью широко используемого носителя живой вакцины LAB [38] . Ген pgsA, используемый в этом исследовании, является якорем для отображения на поверхности LAB, который происходит из ферментного комплекса pgsBCA Bacillus subtilis и состоит из трансмембранного домена рядом с его N-концом с доменом, расположенным снаружи клетки. мембрана.Таким образом, pgsA способен пересекать клеточную стенку и отображать гетерологичный белок, слитый с его С-концом [17].

Разработанные вакцины тестировались двумя основными способами. Мы обнаружили, что вакцинация pgsA-CTA1-sM2 / L. casei способна индуцировать значительно более высокий уровень sM2-специфического сывороточного IgG () и IgA слизистой оболочки () по сравнению с pgsA-sM2 / L. casei , и обеспечивая защиту от различных подтипов гриппа как филогенетической группы 1 (h2, H5, H9), так и группы 2 (H7) [46] ().Это исследование также показало, что i.n. введение было лучше, чем пероральный путь вакцинации, что согласуется с другими наблюдениями [48]. Это явление может объясняться двумя причинами. Во-первых, путь заражения такой же, как и при вакцинации; специфический IgA слизистой оболочки может предотвратить вирусную колонизацию дыхательных путей. Во-вторых, объем посевного материала был в 5 раз меньше, чем объем посевного материала для перорального введения, что могло позволить представить концентрированную форму антигена иммунным клеткам.Поскольку у мышей, иммунизированных интраназально, были обнаружены более высокие уровни сывороточного IgG и IgA слизистой оболочки, чем у мышей, иммунизированных перорально (), альтернативным объяснением может быть то, что антигены по-разному процессируются и / или представляются иммунным клеткам в двух компартментах слизистой оболочки. Важно отметить, что наше исследование впервые продемонстрировало, что иммунизация слизистых оболочек с помощью LAB-отображенной на поверхности CTA1-конъюгированной вакцины-кандидата на основе sM2 индуцировала широкую защиту от заражения различными подтипами гриппа.

Однако механизм, с помощью которого Abs против sM2 опосредует эту широкую защиту, полностью не изучен. Предыдущие исследования показали, что Abs на N-конце M2e, особенно в положениях 1–10, ингибируют репликацию вируса гриппа A [49], [50]. Другие исследования показали, что анти-M2e IgG-опосредованная клеточная цитотоксичность или фагоцитоз могут вызывать удаление инфицированных клеток до образования и распространения потомства вируса [54], [55], что подтверждает наши данные о титре легочного вируса и данные иммуногистохимии, обнаруженные при 5 dpi. в наших экспериментах с вызовами.Следовательно, в этом исследовании комбинация этих ответов и Ат к N-концу последовательности sM2, которая является консервативной среди контрольных вирусов (), может защищать дивергентные подтипы гриппа после иммунизации слизистой оболочки рекомбинантной LAB, конъюгированной с CTA1 вакциной на основе sM2. кандидат. Более того, клеточный иммунный ответ играет важную роль в контроле репликации вируса. Мы исследовали ответы цитокинов Th2-типа (IFN-γ) и Th3-типа (IL-4) с помощью анализа ELISPOT. Значительно более высокие уровни IFN-γ были обнаружены в ответ на стимуляцию как белком sM2, так и пептидом M2 у мышей, иммунизированных pgsA-CTA1-sM2 / L.casei по сравнению с уровнями у мышей в pgsA-sM2 / L. casei и контрольных группах (). Аналогичным образом, существенно высокие уровни IL-4 наблюдались у мышей, иммунизированных pgsA-CTA1-sM2 / L. casei при стимуляции белком sM2 и пептидом M2 (). Эти результаты дополнительно подтверждают выводы о том, что антитела и клеточно-опосредованная цитотоксичность были специфичными для антигена M2 и что их противовирусная активность была индуцирована мономерным M2, тремя копиями M2, слитыми с ASP-1 [34], [51], [52].Вместе эти результаты показывают, что sM2 с адъювантом слитого CTA1 индуцировал иммунные ответы у мышей, которые защищали их от различных подтипов гриппа. В этом отношении наши результаты имеют значение для использования CTA1, который выполняет адъювантную функцию, в вакцинах-кандидатах.

Поскольку клиническая защита - не единственный параметр, по которому оценивается эффективность вакцины, мы оценили иммуногенность рекомбинантной LAB вакцины на основе других параметров, таких как уменьшение патологических поражений и выделение вируса.В этом исследовании низкие титры контрольного вируса титровались в легких после вакцинации pgsA-CTA1-sM2 / L. casei , в то время как контрольный вирус мог быть обнаружен при более высоких титрах у ложных мышей и мышей, вакцинированных pgsA-sM2 / L. casei (). Уменьшение макроскопических и гистопатологических поражений, соответствующих вирусной инфекции, является основным показателем эффективности вакцины против гриппа. Здесь мы продемонстрировали, что вакцинация pgsA-CTA1-sM2 / L. casei значительно ограничивала тяжесть повреждения за счет ингибирования репликации вируса и накопления воспалительных клеток и вирусного антигена в альвеолярных тканях легких по сравнению с серьезностью поражения. неиммунизированных мышей и мышей, вакцинированных pgsA-sM2 / L.casei ().

Наше исследование впервые продемонстрировало, что рекомбинантный L. casei , экспрессирующий CTA1-sM2, индуцирует длительный иммунитет и обеспечивает защиту от летальных инфекций гриппа даже через 6 месяцев после последней вакцинации (), что является важно для любой успешной вакцины. Подобные результаты наблюдались в предыдущих исследованиях, в которых M2 VLP обеспечивали длительный иммунитет и перекрестную защиту, а антитела в сыворотке и участках слизистой оболочки были долгоживущими [53], [54].

В заключение, наши результаты показали, что иммунизация слизистой оболочки мышей рекомбинантным L. casei , экспрессирующим СТА1-конъюгированный sM2, может вызывать системные и местные, а также клеточно-опосредованные иммунные ответы против дивергентных подтипов вируса гриппа. Таким образом, рекомбинантная L. casei , экспрессирующая СТА1-конъюгированную консенсусную вакцину sM2 для слизистой оболочки, может быть многообещающей вакциной-кандидатом для обеспечения готовности к пандемии гриппа.

Вакцина против COVID-19 | Парквью Хелс

Часто задаваемые вопросы: что вы должны знать о вакцине COVID-19

Индиана

Кто имеет право на вакцинацию в Индиане?
Департамент здравоохранения штата Индиана (IDOH) следует рекомендациям Центров по контролю и профилактике заболеваний (CDC) и Консультативной группы по разработке плана распределения вакцин IDOH по приоритезации распределения вакцин эффективным, справедливым и этичным образом.Первый раунд вакцины (так называемая фаза 1а, начавшаяся 14 декабря 2020 г.) была назначена сотрудникам центров долгосрочного ухода и медицинскому персоналу, которые по роду своей работы потенциально могут контактировать с пациентами с COVID-19 или инфекционными заболеваниями. материал. Фаза 1b была объявлена ​​IDOH 6 января 2021 г. Право на участие расширяется по мере появления дополнительных вакцин. Категории получателей определяются IDOH, а Parkview не определяет критерии.

В настоящее время правомочными лицами являются жители Индианы в возрасте от 16 лет и старше; работники здравоохранения; педагоги и школьные работники; ветераны; и другие популяции, перечисленные здесь.Более подробную информацию о соответствии критериям вакцины можно получить в IDOH по адресу http://ourshot.in.gov/.

Как зарегистрироваться и куда поехать в Индиане?

Огайо

Кто имеет право на вакцинацию в Огайо?
Под руководством Департамента здравоохранения штата Огайо (ODH) жители штата Огайо в возрасте 40 лет и старше, а также люди с определенными заболеваниями и лица определенных профессий имеют право на вакцинацию в рамках государственной программы распространения вакцины против COVID-19.Начиная с 29 марта, жители штата Огайо в возрасте 16 лет и старше будут иметь право на вакцинацию.

Новое решение

Ohio для управления вакцинами помогает жителям штата Огайо проверять свое право на участие, находить поставщика и получать новости. Перейдите на сайт https://gettheshot.coronavirus.ohio.gov/, чтобы проверить свое право на участие и назначить встречу.

Как зарегистрироваться и куда поехать в Огайо?

Дополнительная информация

Когда другие люди, не имеющие права на вакцинацию, могут получить вакцину?
Запасы вакцины ограничены.По мере увеличения поставок вакцины будет право на вакцинацию более широкая группа хузеров и жителей Огайо. Сроки для дополнительных фаз введения вакцины еще не определены. Для получения обновлений посетите веб-сайт IDOH ourshot.in.gov или веб-сайт ODH по адресу coronavirus.ohio.gov.

Какие возрастные группы могут получить вакцину после получения критерия?
Первоначально вакцина будет одобрена только для лиц в возрасте 16 лет и старше, так как она еще не изучалась у маленьких детей или беременных / кормящих женщин.Исследования показали, что вакцина эффективна для людей старше 65 лет.

Сколько будет стоить вакцина?
С лица, получающего вакцину, плата не взимается. Однако информация о страховании будет собрана. Федеральные правила гарантируют, что никто не будет платить наличные деньги за введение вакцины. Доплата и плата не взимается с тех, у кого нет страховки.

Вакцина бесплатна, но может взиматься страховка за административный сбор Департаментом здравоохранения штата, в котором вакцина была введена.

Заявление о PPG для пациентов

В Parkview Physician Group мы заботимся о вашем здоровье и призываем наших пациентов пройти вакцинацию от COVID-19, поскольку они имеют право на вакцинацию. Вакцина эффективна и безопасна. Противопоказаний к вакцинации очень мало, и даже те, кто переболел COVID-19, должны получить вакцину. Тяжелые реакции на вакцину очень редки (около 11 на 1 миллион человек, получающих вакцину).Наряду с CDC, PPG считает, что противопоказанием к вакцинации вакцинами Pfizer-BioNTech и Moderna COVID-19 являются следующие случаи:

  • Тяжелая аллергическая реакция (например, анафилаксия) после предыдущей дозы вакцины с мРНК COVID-19 или любого из ее компонентов
  • Немедленная аллергическая реакция любой степени тяжести на предыдущую дозу мРНК вакцины COVID-19 или любого из ее компонентов (включая полиэтиленгликоль [PEG])
  • Немедленная аллергическая реакция любой степени тяжести на полисорбат (из-за потенциальной перекрестной гиперчувствительности с ингредиентом вакцины ПЭГ)
  • Инфузия моноклональных антител в течение последних 90 дней

Американский колледж акушеров и гинекологов (ACOG) рекомендует не отказывать в вакцинации от COVID-19 беременным, которые соответствуют критериям вакцинации на основе рекомендованных ACIP приоритетных групп.Беременные женщины могут обсудить вакцинацию со своим врачом.

Приемлемость вакцины в нашем регионе устанавливается государственными департаментами здравоохранения. Для получения подробной информации и обновлений посетите coronavirus.in.gov/vaccine для Индианы и Программу вакцинации COVID-19 (ohio.gov) для Огайо.


Клиника медицинских вакцин Parkview

Те, кто имеет право на вакцинацию, могут записаться на прием до прибытия в центр Parkview Mirro Center на веб-сайте IDOH ourshot.in.gov или позвонив по телефону 2-1-1. Клиника вакцинации в Центре Parkview Mirro также принимает пациентов в определенные часы.

С 7 июня часы работы будут:

Понедельник

  • Запись на прием: 15.00 - 19:00
  • Вход для посетителей: 15–18.

Пятница

  • Запись на прием: с 11:00 до 15:00.
  • Вход: с 11:00 до 14:00.

суббота

  • Назначения: 8 а.м. - полдень
  • Вход: с 8 до 11 часов

Клиника вакцинации Parkview Health в настоящее время вводит вакцину Pfizer.

В то время как штат разрешает несовершеннолетним получать вакцину вместе с родителями, идущими с несовершеннолетним, или при предоставлении письменного разрешения на то, что несовершеннолетний может получить вакцину, клиника вакцины Parkview требует, чтобы родители или опекун сопровождали несовершеннолетнего, получающего вакцину. . Мы не позволим детям 16 или 17 лет получить вакцину без присутствия их родителей или опекунов.

Соответствующие критериям медицинские работники должны зарегистрироваться на прием заранее по ссылке, предоставленной государством, их работодателем или профессиональными организациями.

Клиника вакцины

Parkview находится по адресу:

.

Парквью Мирро Центр исследований и инноваций
10622 Parkview Plaza Drive, Форт-Уэйн 46845

Маршрут

Центр Мирро расположен на территории кампуса Регионального медицинского центра Парквью. Если у вас назначена встреча в этом месте, воспользуйтесь входом на Диболд-роуд, расположенным к северу от Манчестерского колледжа, и припаркуйтесь на южной парковке перед входом А.Войдите через подъезд A.

Право на вакцинацию и места ее проведения определяются IDOH; Parkview не делает таких определений. Сроки для дополнительных фаз введения вакцины еще не определены. Для получения обновлений посетите веб-сайт IDOH: ourshot.in.gov.

Если в настоящее время вы соответствуете критериям вакцинации и у вас есть вопросы, касающиеся клиники вакцинации Parkview, звоните по телефону 1-877-651-0748 с понедельника по пятницу с 10:00 до 15:00.

По общим вопросам, связанным с вакциной или регистрацией в Индиане, звоните по телефону 2-1-1.


Дополнительные вопросы?

Дополнительную информацию о вакцинации против COVID-19 можно найти на веб-сайте Департамента здравоохранения штата Индиана или Департамента здравоохранения штата Огайо.

AB1091 Переносимость вакцинации 13 pcv у пациентов с цзя без системных проявлений

Abstract

Предпосылки Ювенильный идиопатический артрит (ЮИА) - одно из наиболее частых и инвалидизирующих ревматических заболеваний у детей.Дети с ЮИА, получающие иммуносупрессивные и генно-инженерные биологические препараты, относятся к группе высокого риска развития бактериальных и вирусных инфекций, в том числе тех, которые вводятся с помощью профилактических вакцин.

Цели Нашей целью было оценить переносимость пневмококковой 13-валентной конъюгированной вакцины (ПКВ) у детей с ЮИА.

Методы В проспективном когортном исследовании были сформированы 3 группы: дети с ЮИА в фазе ремиссии на метотрексате или этанерцепте (группа I), с ЮИА в активной фазе до назначения метотрексата или этанерцепта (группа II) , контрольная группа (условно здоровые дети).0,5 мл 13-валентной ПКВ вводили однократно подкожно во время терапии пациентам в фазе ремиссии или за 3 недели до назначения метотрексата или этанерцепта пациентам в активной фазе.

Результаты На данном этапе работы оценивалась переносимость вакцины 13 PCV у пациентов с ЮИА без системных проявлений. В нашем исследовании поствакцинальный период протекал бессимптомно у 58% детей I группы, 66% детей II группы и 60% контрольной группы.Чаще всего в поствакцинальном периоде отмечались местные реакции, болезненные в месте введения вакцины у 6% детей в I группе, 8% во II группе и 24% в контрольной группе соответственно. Менее развиты отек и гиперемия в месте инъекции - у 12% детей I группы, 6% во II группе, у 8% детей контрольной группы. Достоверной разницы в частоте местных реакций на вакцинацию 13 ПКВ у пациентов с ЮИА и у детей контрольной группы не было.Анализ времени возникновения и продолжительности местных и системных реакций на вакцинацию 13 ПКВ показал, что максимальная выраженность симптомов отмечалась в первые сутки, к 2–3 суткам наблюдения исчезли жалобы и лихорадка. Через 2 дня после иммунизации отмечалось усиление местных реакций с последующим исчезновением к 3–4 дням наблюдения. В поствакцинальный период серьезных нежелательных явлений не было.

Выводы Вакцинация 13-валентной ПКВ детям с ЮИА безопасна и не сопровождается развитием серьезных нежелательных явлений.

Раскрытие интересов Е. Алексеева Грант / исследовательская поддержка от: Roche, Pfizer, Centocor, Novartis, Т. Дворяковская Грант / исследовательская поддержка: Roche, Pfizer, М. Солошенко: не заявлено, Р. Денисова: не заявлено , К. Исаева: Не заявляли, А. Мамутова: Не заявляли, Н. Маянский: Не заявляли, Н. Ткаченко: Не заявляли, И. Зубкова: Не заявляли, Т. Калужная: Не заявляли, А. Гайворонская: Не заявляли, М. Броева: Не декларировалось, М. Федосеенко: Не декларировалось

Сколько стоит частное медицинское страхование в Германии

Немецкое частное медицинское страхование - вариант для людей, которые либо зарабатывают более 64 350 евро в год (на 2021 год), либо работают не по найму.Кроме того, государственные служащие могут также приобрести частную медицинскую страховку, которая на немецком языке называется Private Krankenversicherung (PKV). Стоимость PKV значительно различается в зависимости от того, какие услуги вы хотите получить и от каких обстоятельств. Для приблизительной оценки заполните сравнительную форму немецкого частного медицинского страхования, чтобы узнать, сколько другие платят за свою страховку. Важные критерии включают ваш возраст, вес, семейное положение, детей, текущее состояние здоровья и многое другое.

Между PKV и более распространенным Gesetzliche Krankenversicherung (GKV) существуют различные различия.. Каждый имеет право застраховаться через GKV, тогда как PKV открыт только для тех, кто относится к ранее упомянутым категориям. Наличие какой-либо медицинской страховки в Германии является юридическим требованием, и многие иностранные специалисты, работающие здесь, предпочитают частное страхование установленному законом.

Тем не менее, многие люди, особенно те, кто зарабатывает больше, выбирают ПКВ. Одна из основных причин - лучшее качество обслуживания. Вы можете выбирать из более широкого круга врачей, что является важным фактором, поскольку многие врачи общей практики отказываются принимать новых клиентов по обязательному медицинскому страхованию (GKV).Покрытие PKV - большой плюс к поиску подходящего врача. Для ночлега в больнице PKV также предлагает различные варианты, в зависимости от вашего плана, для вашей собственной комнаты, дополнительных лекарств, расширенных услуг и т. Д.

Одним из наиболее важных аспектов немецкого частного медицинского страхования является фиксированная ставка страховых взносов. Обязательное медицинское страхование выплачивается в процентах от вашей заработной платы. Чем больше вы зарабатываете, тем больше платите. Частное медицинское страхование не работает таким образом, и вместо этого будет зависеть от вашей общей физической формы, вариантов, на которые вы подписаны, и некоторых других критериев.Однако с годами взносы в PKV медленно растут вместе с инфляцией.

Итак, из-за огромной изменчивости PKV рекомендуется поговорить с квалифицированным брокером, который может провести вас через процесс без каких-либо обязательств. Таким образом, вы сможете решить, какие услуги лучше всего подходят для вас и вашей семьи, если они у вас есть.

The Eye Newspapers имеет соглашение с HanseMerkur, одной из ведущих немецких компаний по страхованию здоровья, ориентированной на экспатриантов.Чтобы получить ценовое предложение без обязательств, заполните нашу форму расчета стоимости медицинского страхования в Германии.

Изображение Марека Студзински

dpa Международный

стрельба со смертельным исходом • Два палестинских офицера безопасности убиты израильским подразделением на Западном берегу

поиск выживших • 11 человек погибли в результате обрушения здания в Мумбаи из-за дождей

Неравный доступ • Меркель по-прежнему против отмены патентов на вакцины в преддверии саммита G7

выборы президента • Иранский кандидат призывает молодых избирателей помочь сохранить статус-кво

Рейнхард Маркс • Папа отверг отставку немецкого епископа на фоне кризиса сексуального насилия в церкви

Евро-2020 • Полный состав для Германии на первой тренировке в Херцогенаурахе

Франциска Гиффи • Бывший министр по делам семьи Германии лишен докторской степени

осторожно в путешествии • Сингапур ослабляет ограничения на распространение вируса Covid, но пузырь путешествий в Гонконг остается в силе

внешняя политика • Саммит G7 обсудит нарушение Россией норм

Пресс-релиз • 4YFN движется к сердцу MWC, помещая стартапы в центр мобильной экосистемы

Пресс-релиз • Исследование TNO показывает эффективность пушки Corona

Пресс-релиз • ForwardPMX становится мстителем моды, присоединившись к динамичному движению за усиление роли индустрии моды в достижении глобальных целей ООН

Пресс-релиз • Платформа электронной коммерции в Юго-Восточной Азии Lazada запускает публичную программу вознаграждения за ошибки с YesWeHack

Пресс-релиз • CAPEX.com Расширяет портфель криптовалют 12 новыми дополнениями

Пресс-релиз • CAPEX.com расширяет портфель криптовалют 12 новыми дополнениями

Пресс-релиз • Новый прогноз: Бельгия станет фаворитом чемпионата Европы, Англия вылетит в 1/8 финала

Пресс-релиз • Oryx Stainless Group открывает новую верфь в Испании

Пресс-релиз • Генеральный директор PODA представил корпоративный отчет

Пресс-релиз • Heidelberg ожидает прибыльного роста в 2021/2022 финансовом году и в последующие годы

Пресс-релиз • Heidelberg ожидает прибыльного роста в 2021/2022 финансовом году и в последующие годы

Пресс-релиз • NextChem и Пол Вурт объединяют усилия для разработки инновационных низкоуглеродных решений для сталелитейной промышленности

Пресс-релиз • УЧЕНЫЕ ПО ВСЕМУ МИРУ ДОВЕРЯЮТ НАУКЕ В ПРАЗДНИКЕ МЕЖДУНАРОДНОГО ДНЯ СВЕТА

Пресс-релиз • Enfinity Global назначает Франческо Косулича главой европейских фондов

Пресс-релиз • Loop Energy и GreenCore объединили лучшие в своем классе технологии в водородных зарядных устройствах для электромобилей нового поколения

Пресс-релиз • BMW Group объявляет о глобальном партнерстве с Bayerische Staatsoper / Расширение долгосрочного партнерства является вкладом в усилия по социальной ответственности и дает новые импульсы для известного оперного театра Мюнхена

.

результатов исследований, финансируемых SHIC, в анализе rRT-PCR в реальном времени для PKV - Информационный центр здоровья свиней

Информационный центр по здоровью свиней (SHIC) наблюдает за кобувирусом свиней (PKV) как возможным появляющимся вирусом свиней, представляющим реальную угрозу для свиноводства США.Первоначально обнаруженный в 2008 году у поросят в Венгрии, PKV был обнаружен во всем мире, в том числе в США в 2013 году. Финансируемое SHIC исследование, проведенное в Университете штата Айова, привело к разработке и валидации метода ПЦР с обратной транскриптазой в реальном времени (rRT-PCR). ) для обнаружения штаммов PKV, циркулирующих у американских свиней. Процесс валидации ПЦР привел к получению данных, свидетельствующих о том, что PKV широко распространен у свиней в США, и необходимы дополнительные исследования, чтобы определить, инфицированы ли свиньи с диареей или без нее PKV или другие штаммы вируса с большей вероятностью вызывают диарею у свиней.Инфекция PKV чаще всего представляет собой легкое диарейное заболевание, у поросят в возрасте до четырех недель наиболее вероятно инфицирование. Распространенность среди домашних свиней колеблется от 13 до 99 процентов, и вирус был изолирован как от здоровых свиней, так и от свиней с диареей. PKV эндемичен во многих странах и изолирован во всем мире. В Китае PKV считается причиной диареи, обезвоживания и рвоты у поросят, что привело к заболеваемости от 80 до 100 процентов и смертности от 50 до 90 процентов, начиная с 2010 года.В резюме исследования авторы говорят, что это предполагает, что появление PKV из разных географических регионов можно обнаружить с помощью мишеней, основанных на штаммах PKV в США. Вакцины или противовирусные препараты для лечения PKV у свиней не разработаны. Надлежащая санитария и карантин больных свиней должны помочь предотвратить и контролировать возможные вспышки. Это финансируемое SHIC исследование является важным шагом к выявлению одного из вирусов, который может угрожать свиноводству США. В результате этого исследования свиноводство разработало методику обнаружения китайских штаммов потенциально патогенных штаммов PKV.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *